KEGG   Pan paniscus (bonobo): 100990543
Entry
100990543         CDS       T02283                                 

Gene name
OGFOD1
Definition
(RefSeq) 2-oxoglutarate and iron dependent oxygenase domain containing 1
  KO
K24029  prolyl 3-hydroxylase /prolyl 3,4-dihydroxylase [EC:1.14.11.-]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100990543 (OGFOD1)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     100990543 (OGFOD1)
SSDB
Motif
Pfam: Ofd1_CTDD 2OG-FeII_Oxy_4 2OG-FeII_Oxy_3
Other DBs
NCBI-GeneID: 100990543
NCBI-ProteinID: XP_003823826
UniProt: A0A2R9AE79
Position
16
AA seq 542 aa
MNGKRPAEPGAARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDP
FLHCVIPNFIQSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILF
EDFRSWLSDISKIDLESTIDMSCAKYEFTDALLCHDDELEGRRIAFILYLVPPWDRSLGG
TLDLYSIDELFQPKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGP
SLTRPPNYFEPPIPRTPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLK
PEKFTKVCEALEHGDVEWSSRGPPNKRFYEKAEESTLPEILKECMKLFRSEALFLLLSNF
TGLKLHFLAPSEEDEMNDKKEAETADITEEGTSHNHPEPENNQTAISNNSQQSSEQTDPE
PEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTS
YIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIY
YE
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaatgggaagcggccagcggagcccggcgcagcccgggtgggaaaaaagggaaagaag
gaggtgatggcggagttttcggacgctgttacggaagaaaccttgaaaaagcaggtggct
gaggcctggagccgcaggacgccgttcagtcacgaagtcattgtcatggacatggaccct
tttcttcactgtgtgatcccaaacttcatccaaagccaagacttcttagaagggcttcag
aaggaactgatgaacttggacttccatgagaagtataatgatttatataagttccagcag
tctgatgatttgaagaagagaagagagcctcacatctccactttaaggaaaattctgttt
gaagatttccggtcctggctttctgatatttctaaaattgacctggaatcaaccattgac
atgtcctgtgctaaatatgaattcactgatgccctgctgtgccatgatgatgagctggaa
gggcgccggattgccttcatcctgtacctggttcctccctgggacaggagcctgggtggt
accctggacctgtacagcattgatgaactctttcagccgaagcagattgtcaagtctctt
atcccttcgtggaacaaactggttttctttgaagtatctcctgtgtcctttcaccaggtg
tctgaagtcctgtctgaagaaaagtcacgtttgtctataagtggctggtttcatggtcca
tcgttgactcggcctcccaactactttgaaccccccatacctcggacccctcacatccca
caagatcatgagattttgtatgattggatcaaccctacttatctggacatggattaccaa
gttcaaattcaagaagagtttgaagaaagttctgaaattctcctgaaggagtttcttaag
cctgagaaattcacgaaagtctgtgaggccttggagcatggagatgtggaatggagcagc
cgaggtccccctaacaaaaggttttatgagaaagctgaggagagtacgcttcctgagata
ttgaaggagtgcatgaagttatttcgctctgaggcactattcttgctgctctccaacttc
acaggcctgaagcttcatttcttggccccttcggaagaagatgagatgaatgataaaaaa
gaggcagaaaccgctgatatcactgaagaagggactagccataatcatcctgagccagag
aataatcagacggccatcagcaacaacagccaacagagcagtgagcagacagacccagag
ccagaggaaaatgaaacaaagaaagaatcaagtgttcccatgtgccaaggggaactgagg
cattggaagaccggtcactacactttaattcatgaccatagcaaggctgaatttgcccta
gacttaattctgtactgtggctgtgaaggctgggagccagaatatggcggttttacttct
tacattgccaaaggtgaagatgaagagctgctaacagtgaatccagaaagcaattctttg
gcattggtctacagagatagagagactctgaaatttgtcaagcatattaaccaccgaagc
ctggaacaaaagaaaaccttcccaaacagaacaggtttctgggacttttcattcatctat
tatgaatga

DBGET integrated database retrieval system