KEGG   Pan paniscus (bonobo): 100990601
Entry
100990601         CDS       T02283                                 

Gene name
TG
Definition
(RefSeq) thyroglobulin
  KO
K10809  thyroglobulin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04918  Thyroid hormone synthesis
pps05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100990601 (TG)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100990601 (TG)
SSDB
Motif
Pfam: COesterase Thyroglobulin_1 Ephrin_rec_like NCD3G Abhydrolase_3
Other DBs
NCBI-GeneID: 100990601
NCBI-ProteinID: XP_003830134
UniProt: A0A2R9AW86
Position
8
AA seq 2769 aa
MALILEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQT
VQCQNDGRSCWCVGADGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQC
QDSGDYTPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSP
PQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFAEVSGYCHCADS
QGRELAETGLELLLDEIYDTVFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTK
CEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAE
GQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFAASCPPTIKELFVDSG
LLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNV
GQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKK
DGTMNKPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGEVME
TVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFAGECWCVNSWGKELPGSRVRGGQPRCPT
DCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAT
GKPKKCPTPCQLQAEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWRQVQCDGPPEQ
VFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEPGQQDVFPVLSQYP
SLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWC
VDEAGQELEGTRAEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVA
KGIRLRNEDLGLPPLFPPREAFAEQFLRGSDYAIRLAAQSTLSFYQRRRFPPDDSAGASA
LLRSGPYVPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPASLTARSLQIPQCPTTCEKS
RTSGLLSSWKQARSQENSSPRDLFIPACLETGEYARLQASGAGTWCVDPASGEELRPGSN
SSAQCPSLCSVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPG
TRVAGGQPACESPRCPLPFNASEVVGGTILCETTSGPTGAAIQQCQLLCRQGSWSVFPPG
PLICSLESGRWESQPPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYASLLQTFQVF
ILDELMARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTSERLGVNVTWKSRLEDIPVASL
PDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETTIRFLQGDHFGTSPRTWFG
CSEGFYQVLTSEASQDGLGCVKCPEGSYSQDEECIPCPVGFYQEQAGSLACVPCPVGRMT
ISAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAP
LEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTEDEACSFFTVS
TMEPEISCDFYAWTSDNVACMTSDQKQDALGNSKATSFGSLRCQVKVRSRGQDSPAVYLK
KGQGSTTTLQKSFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVL
TRVQGGAIICGLLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGGQEFI
KSLTPLEGTQDTFTNFQQVYLWKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPV
DLNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTC
TLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIR
NKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGKVTCLTLNSLGIQMCSEEN
GGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDLWQSLALS
SVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYAD
TQSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVG
TSWKQVDQFLGVPYAAPPLAERRFRAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSE
DCLYLNVFIPQNVAPNVSVLVFFHNTMDGEESEGWPAIDGSFLAAVGNLIVVTASYRVGV
FGFLSSGSGDVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLMA
RATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPA
SVLNDAQTKLLAVSGPFHYWGPVIDGQFLREPPARALKRSLRVEVDLLIGSSQDDGLINR
AKAVKQFEESQGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRA
LENATRDYFIICPIIDMASAWAKRARGNVFMYHAPESYGRGSLELLADVQFAFGLPFYPA
YEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKE
FSALLPNRQGLKKADCSFWSKYISSLKASADGAKGGKSAESEEEELTAGSGLREDLLSLQ
EPGSKSYSK
NT seq 8310 nt   +upstreamnt  +downstreamnt
atggccctgatcctggagatcttcaccctgctggcctccatctgctgggtgtcggccaat
atcttcgagtaccaggtggatgcccagccccttcgtccctgtgagctgcagagggaaaca
gcctttctgaagcaagcagactacgtgccccagtgcgcagaggatggcagcttccagact
gtccagtgccagaacgatggccgctcctgctggtgtgtgggtgccgacggcagtgaagtg
ctgggcagcaggcagccaggacggcctgtggcttgtctgtcattttgtcagctacagaaa
cagcagatcttactgagtggctacattaacagcacagacacctcctacctccctcagtgt
caggattcaggggactacacgcctgttcagtgtgacgtgcagcaggtccagtgctggtgt
gtggacgcagaggggatggaggtgtatgggacccgccagctggggaggccaaagcgatgt
ccaaggagctgtgaaataagaaatcgtcgtcttctccacggggtgggagataagtcacca
ccccagtgttctgcggagggagagtttatgcctgtccagtgcaaatttgtcaacaccaca
gacatgatgatttttgatctggtccacagctacaacaggtttccagatgcatttgtgacc
ttcagttccttccagaggaggttcgctgaggtatctgggtattgccactgtgctgacagc
caagggcgggaactggctgagacaggtttggagttgttactggatgaaatttatgacacc
gtttttgctggcctggaccttccttccaccttcactgaaaccaccctgtaccggatactg
cagagacggttcctcgcagttcaatcagtcatctctggcagattccgatgccccacaaaa
tgtgaagtggagcggtttacagcaaccagctttggtcacccctatgttccaagctgccgc
cgaaatggcgactatcaggcggtgcagtgccagacggaagggccctgctggtgtgtggac
gcccaggggaaggaaatgcatggaacccggcagcaaggggagccgccatcttgtgctgaa
ggccaatcttgtgcctccgaaaggcagcaggccttgtccagactctactttgggacctca
ggctacttcagccagcacgacctgttctcttccccagagaaaagatgggcctctccaaga
gtagccagatttgccgcatcctgcccacccacgatcaaggagctctttgtggactctggg
cttctccgcccaatggtggagggacagagccaacagttttctgtctcagaaaatcttctc
aaagaagccatccgagcaatttttccctcccgagggctggctcgtcttgcccttcagttt
accaccaacccaaagagactccagcaaaacctttttggagggaaatttttggtgaatgtt
ggccagtttaacttgtctggagcccttggcacaagaggcacatttaacttcagtcaattt
ttccagcaacttggtcttgcaagcttcttgaatggagggagacaagaagatttggccaag
ccactctctgtgggattagattcaaattcttccacaggaacccctgaagctgctaagaag
gatggtactatgaataagccaactgtgggcagctttggctttgaaattaacctacaagag
aaccaaaatgccctcaaattccttgcttctctcctggagcttccagaattccttctcttc
ttgcaacatgctatctctgtgccagaagatgtggcaagagatttaggtgaagtgatggaa
acggtactcagctcccagacctgtgagcagacacctgaaaggctatttgtcccatcatgc
acgacagaaggaagctatgaagatgtccaatgctttgccggagagtgctggtgtgtgaat
tcctggggcaaagagcttccaggctcaagagtcagaggtggacagccgaggtgccccaca
gactgtgaaaagcaaagggctcgcatgcaaagcctcatgggcagccagcctgctggctcc
accttgtttgtccctgcttgtactagtgagggacatttcctgcctgtccagtgcttcaac
tcagagtgctactgtgttgatgctgagggtcaggccattcctggaactcgaagtgcaaca
gggaagcccaagaaatgccccacgccctgtcaattacaggctgagcaagctttcctcagg
acggtgcaggccctgctctctaactccagcatgctacccaccctttccgacacctacatc
ccacagtgcagcaccgatgggcagtggagacaagtgcaatgcgatgggcctcccgagcag
gtcttcgagttgtaccaacgatgggaggctcagaacaagggccaggatctgacgcctgcc
aagctgctagtgaagatcatgagctacagagaagcagcttccggaaacttcagtctcttt
attcaaagtctgtatgagcctggccagcaagatgtcttcccggtgctgtcacaataccct
tctctgcaagatgtcccactagcagcactggaagggaaacggccccagcccagggagaat
atcctcctggagccctacctcttctggcagatcttaaatggccaactcagccaatacccg
ggctcctactcagacttcagcactcctttggcacatttcgatcttcggaactgctggtgt
gtggatgaggctggccaagaactggaaggaacgcgggctgagccaagcaagctcccaaca
tgtcctggctcctgtgaggaagcgaagctccgtgtactgcagttcattagggaaacggaa
gagattgtttcagcttccaacagttctcggttccctctgggggagagtttcctggtggcc
aagggaatccggctgaggaatgaggacctcggccttcctccgctcttcccgccccgggag
gctttcgcggagcagtttctgcgcgggagtgattacgccattcgcctggcggctcagtct
accttaagcttctatcagagacgccgctttcccccggacgactcggctggagcatccgcc
cttctgcggtcgggcccctacgtgccacagtgtgatgcgtttggaagttgggagcctgtg
cagtgccacgctgggactgggcactgctggtgtgtagatgagaaaggagggttcatccct
gcctcactgactgcccgctctctgcagattccacagtgcccgacaacctgcgagaaatct
cgaaccagtgggctgctttccagttggaaacaggctagatcccaagaaaactcatctcca
agagacctgttcatcccagcctgcctagagacaggagagtatgccaggctgcaggcatcg
ggggctggcacctggtgtgtggaccctgcatcaggagaagagttgcgtcctggctcgaac
agcagtgcccagtgcccaagcctctgcagtgtgctcaagagtggagtcctctccaggaga
gtcagcccaggctatgtcccagcctgcagggcagaggatgggggcttttccccagtgcaa
tgtgaccaggcgcagggcagctgctggtgtgtcatggacagcggagaagaggtgcctggg
acgcgcgtggccgggggccagcccgcctgtgagagcccgcggtgtccgctgccattcaac
gcgtcggaggtggttggtggaacaatcctgtgtgagacaacctcgggccccacaggggct
gccatccagcagtgccaattgctgtgccgccagggctcctggagcgtgtttccaccaggg
ccattgatatgtagcctggagagcggacgctgggagtcacagccgcctcagccccgggcc
tgccaacggccccagctgtggcagaccatccagacccaagggcactttcagctccagctc
ccgccgggcaagatgtgcagtgctgactatgcgagtttgctgcagactttccaggttttc
atattggatgagctgatggcccgcggcttctgccagatccaggtgaagacttttggcacc
ctggtttccattcctgtctgcaacaactcctctgtgcaggtgggttgtctgaccagcgag
cgtttaggagtgaatgttacatggaaatcacggcttgaggacatcccagtagcttctctt
cctgacttacatgacattgagagagccttggtgggcaaggatctccttgggcgcttcaca
gatctgatccagagtggctcattccagcttcatctggactccaagacgttcccagcggaa
accaccatccgcttcctccaaggggaccactttggcacctctcccaggacatggtttggg
tgctcggaaggattctaccaagtcttgacaagtgaggccagtcaggacggactgggatgc
gttaagtgtcctgaaggaagctattcccaagatgaggaatgcattccttgtcctgttgga
ttctaccaagaacaggcagggagcttggcctgtgtcccatgtcctgtgggcagaatgacc
atttctgccggagctttcagccagactcactgtgtcacagactgtcagaggaacgaagca
ggcctgcaatgtgaccagaatggccagtatcgagccagccagaaggacaggggcagtggg
aaggccttctgtgtggatggcgaggggcggaggctgccatggtgggaaacagaggcccca
cttgaggactcacagtgtttgatgatgcagaagtttgagaaggttccagaatcaaaggtg
atcttcgacgccaatgctcctgtggctgtcagatccaaagttcctgattctgagttcccc
gtgatgcagtgcttgacagattgcacagaggacgaggcctgcagcttcttcaccgtgtcc
acgatggagccagagatttcctgtgatttctatgcttggacaagtgacaatgttgcctgc
atgacttctgaccagaaacaagatgcactggggaactcgaaggccaccagctttggaagt
cttcgctgccaggtgaaagtgaggagccgtggtcaagattctccagctgtgtatttgaaa
aagggccaaggatccaccacaacacttcagaaaagctttgaacccactggtttccaaaac
atgctttctggattgtacaaccccattgtgttctcagcctcaggagccaatctgaccgat
gctcacctcttctgtcttcttgcatgcgaccgtgatctgtgttgcgatggcttcgtcctc
acacgggttcaaggaggtgccatcatctgtgggttgctgagctcacccagtgtcctgctt
tgtaatgtcaaagactggatggatccctctgaagcctgggctaatgctacatgtcctggt
gtgacatatgaccaggagagccaccaggtgatattgcgtcttggaggccaggagttcatc
aagagtctgacaccgctagaaggaactcaagacacctttaccaattttcagcaggtttat
ctctggaaagattctgacatggggtctcggcctgagtctatgggatgtagaaaagacaca
gtgccaaggccagcatctccaacagaagcaggtttgacaacagaacttttctcccctgtg
gacctcaaccaggtcattgtcaatggaaatcaatcactatccagccagaagcactggctt
ttcaagcacctgttttcagcccagcaggcaaacctgtggtgcctttctcgttgtgtgcag
gagcactctttctgtcagctcgcagagataacagagagtgcatccttgtacttcacctgc
accctctacccagaggcacaggtgtgtgatgacatcatggagtccaatgcccagggctgc
agactgatcctgcctcagatgccaaaggccctgttccggaagaaagttatactggaagat
aaagtgaagaacttttacactcgcctgccattccaaaaactgatggggatatccattaga
aataaagtgcccatgtctgaaaaatctatttctaatgggttctttgaatgtgaacgacgg
tgcgatgcggacccatgctgcactggctttggatttctaaatgtttcccagttaaaagga
ggaaaagtgacatgtctcactctgaacagcttgggaattcagatgtgcagtgaggagaat
ggaggagcctggcgcattttggactgtggctctcctgacattgaagtccacacctatccc
ttcggatggtaccagaagcccattgctcaaaataatgctcccagtttttgccctttggtt
gttctgccttccctcacagagaaagtgtctctggacttgtggcagtcgctggccctctct
tcagtggttgttgatccatccattaggcactttgatgttgcccatgtcagcactgctgcc
accagcaatttctctgctgtccgagacctctgtttgtcggaatgttcccaacatgaggcc
tgtctcatcaccactctgcaaacccaacctggggctgtgagatgtatgttctatgctgat
actcaaagctgcacacatagtctgcagggtcagaactgccgacttctgcttcgtgaagag
gccacccacatctaccggaagccaggaatctctctgctcagctatgaggcatctgtacct
tctgtgcccatttccacccatggccggctgctgggccggtcccaggccatccaggtgggt
acctcatggaagcaagtggaccagttccttggagttccatatgctgccccacccctggca
gagaggcgcttccgggcaccagagcccttgaactggacaggctcctgggatgccagcaag
ccaagggccagctgctggcagccaggcaccagaacatccacgtctcctggagtcagtgaa
gattgtttgtatctcaatgtgttcatccctcagaatgtggcccctaacgtgtctgtgctg
gtgttcttccacaacaccatggacggggaggagagtgaaggatggccggctatcgacggc
tccttcttggctgctgttggcaacctcatcgtggtcactgccagctaccgagtgggtgtc
ttcggcttcctgagttctgggtccggagacgtgagtggcaactgggggctgctggaccag
gtggcggctctgacctgggtgcagacccacatccgaggatttggcggggaccctcggcgc
gtgtccctggcagcagaccgtggcggggctgatgtggccagcatccaccttctcatggcc
agggccaccaactcccaacttttccggagagctgtgctgatgggaggctccgcactctcc
ccggccgccgtcatcagccatgagagggctcagcagcaggcaattgctttggcaaaggag
gtcagctgccccatgtcatccagccaagaagtggtgtcctgcctccgccagaagcctgcc
agtgtcctcaatgatgcccagaccaagctcctggccgtgagtggccctttccactactgg
ggtcctgtgattgatggccagttcctccgtgagcctccagccagagcactgaagaggtct
ttacgggtagaggtcgatctgctcattgggagttctcaggacgatgggctcatcaacaga
gcaaaggctgtgaagcaatttgaggaaagtcaaggccggaccagtagcaaaacagccttt
taccaggcactgcagaattctctgggcggcgaggactcagatgcccgcgtcgaggctgct
gctacatggtattactctctggagcactccacggatgactatgcctccttctcccgggct
ctggagaatgccacccgggactactttatcatctgccctataatcgacatggccagtgcc
tgggcaaagagggcccgaggaaacgtcttcatgtaccatgctcctgaaagctacggccgt
ggcagcctggagttgctggcggatgttcagtttgcctttgggcttcccttctacccagcc
tacgaggggcagttttctctggaggagaagagcctgtcgctgaaaatcatgcagtacttt
tcccacttcatcagatcaggaaatcccaactacccttatgagttctcacggaaagtaccc
acatttgcaaccccctggcctgactttgtaccccgtgctggtggagagaactacaaggag
ttcagtgcgctgctccccaatcgacagggcctgaagaaagccgattgctccttctggtcc
aagtacatctcgtctctgaaggcatctgcagatggagccaagggcgggaagtcagcagag
agtgaagaggaggagttgacggctggatctgggctaagagaagatctcctaagcctccag
gaaccaggctctaagagctacagcaagtga

DBGET integrated database retrieval system