KEGG   Pan paniscus (bonobo): 100990622
Entry
100990622         CDS       T02283                                 

Gene name
TNFRSF17
Definition
(RefSeq) TNF receptor superfamily member 17
  KO
K05153  tumor necrosis factor receptor superfamily member 17
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100990622 (TNFRSF17)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100990622 (TNFRSF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100990622 (TNFRSF17)
   04090 CD molecules [BR:pps04090]
    100990622 (TNFRSF17)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100990622 (TNFRSF17)
CD molecules [BR:pps04090]
 Proteins
  100990622 (TNFRSF17)
SSDB
Motif
Pfam: BCMA-Tall_bind TACI-CRD2 Adipogenin ADPrib_exo_Tox
Other DBs
NCBI-GeneID: 100990622
NCBI-ProteinID: XP_003832741
UniProt: A0A2R9B7E5
Position
16
AA seq 184 aa
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
GLSLIISLAVFVLMFLLRKISSEPLKDEFKNTGSGFLGMANIDLEKSRTGDEIILPRGLE
YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS
ISAR
NT seq 555 nt   +upstreamnt  +downstreamnt
atgttgcagatggctgggcagtgctcccaaaatgaatattttgacagtttgttgcatgct
tgcataccttgtcaacttcgatgttcttctaatactcctcctctaacatgtcagcgttat
tgtaatgcaagtgtgaccaattcagtgaaaggaacgaatgcgattctctggacctgtttg
ggactgagcttaataatttctttggcagttttcgtgctaatgtttttgctaaggaagata
agctctgaaccattaaaggacgagtttaaaaacacaggatcaggtttcctgggcatggct
aacattgacctggaaaagagcaggactggtgatgaaattattcttccgagaggcctcgag
tacacggtggaagaatgcacctgtgaagactgcatcaagagcaaaccgaaggtcgactct
gaccattgctttccactcccagctatggaggaaggcgcaaccattcttgtcaccacgaaa
acgaatgactattgcaagagcctgccagctgctttgagtgctacggagatagagaaatca
atttctgctaggtaa

DBGET integrated database retrieval system