KEGG   Pan paniscus (bonobo): 100990640Help
Entry
100990640         CDS       T02283                                 

Gene name
ADSL
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps00250  Alanine, aspartate and glutamate metabolism
pps01100  Metabolic pathways
Module
pps_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
pps_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100990640 (ADSL)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100990640 (ADSL)
Enzymes [BR:pps01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     100990640 (ADSL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 ADSL_C DUF4089 HTH_Tnp_Tc5 DUF1331
Motif
Other DBs
NCBI-GeneID: 100990640
NCBI-ProteinID: XP_008973372
UniProt: A0A2R9AAB3
Position
22
AA seq 484 aa AA seqDB search
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDE
QIQEMKSNLDNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITG
QTYTRKVDIEILSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMTLVVDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISE
GLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGD
NDLIERIQADAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
ELCL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcagctggaggcgatcatggttcgcccgacagctaccgctcacctcttgcctcccgc
tatgccagcccggagatgtgcttcgtgtttagcgacaggtataaattccggacatggcgg
cagctgtggctgtggctggcggaggccgagcagacattgggtttgcctatcacagatgaa
caaatccaggagatgaaatcaaacctggacaacatcgacttcaagatggcagctgaggaa
gagaaacgtttacgacatgatgtgatggctcacgtgcacacatttggccactgctgtcca
aaagctgcaggcattattcaccttggtgctacttcttgctatgttggagacaatactgac
ttgattattcttagaaatgcacttgacctgcttttgccaaagcttgccagagtgatctct
cggcttgccgactttgctaaggaacgagccagtctacccacattaggtttcacacatttc
cagcctgcacagctgaccacagttgggaaacgttgctgtctttggattcaggatctttgc
atggatctccagaacttgaagcgtgtccgagatgacctgcgcttccggggagtaaagggc
accactggcactcaggccagtttcctgcagctctttgagggagatgaccataaggtagag
cagcttgacaagatggtgacagaaaaggcaggatttaagagagctttcatcatcacaggg
cagacatatacacgaaaagtggatattgaaatactgtctgtgctggctagcttgggggca
tcagtgcacaagatttgcaccgacatacgcctcctggcaaacctcaaggagatggaggaa
ccctttgaaaaacagcagattggctcaagtgcgatgccatataagcggaatcccatgcgt
tcagaacgttgctgcagtcttgcccgccaccttatgaccctcgtcgtggacccgctacag
acagcatctgtccagtggtttgaacgcacactggatgatagtgccaaccgacggatctgt
ttggccgaggcatttcttaccgcagatactatattgaatacgctgcagaacatttctgaa
ggattggtcgtgtaccccaaagtaattgaacggcgcattcggcaagagctgcctttcatg
gccacagagaacatcatcatggccatggtcaaagctggaggtagccgccaggattgccat
gagaaaatcagagtgctttctcagcaggcagcttctgtggttaagcaggaagggggtgac
aatgacctcatagagcgtatccaggctgatgcctacttcagtcccattcactcccagttg
gatcatttactggatccttcttctttcactggtcgtgcctcccagcaggtgcagagattc
ttagaagaggaggtgtatcccctgttaaaaccatatgaaagcgtgatgaaggtgaaagca
gaattatgtctgtag

DBGET integrated database retrieval system