KEGG   Pan paniscus (bonobo): 100990701
Entry
100990701         CDS       T02283                                 

Gene name
AKR1A1
Definition
(RefSeq) aldo-keto reductase family 1 member A1
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00040  Pentose and glucuronate interconversions
pps00561  Glycerolipid metabolism
pps01100  Metabolic pathways
Module
pps_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100990701 (AKR1A1)
   00040 Pentose and glucuronate interconversions
    100990701 (AKR1A1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100990701 (AKR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100990701 (AKR1A1)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     100990701 (AKR1A1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100990701 (AKR1A1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 100990701
NCBI-ProteinID: XP_003812814
UniProt: A0A2R9ABJ2
Position
1
AA seq 325 aa
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcttcctgtgttctcctgcacactgggcagaagatgcctctgattggtctgggt
acctggaagagtgagcctggtcaggtaaaagcagctgttaagtatgcccttagtgtaggc
taccgccacattgattgtgctgctatctacggcaatgagcctgagattggggaggccctg
aaggaggacgtgggaccaggcaaggcggtgcctcgggaggagctgtttgtgacatccaag
ctgtggaacaccaagcaccaccccgaggatgtggagcctgccctccggaagactctggct
gacctccagctggagtatctggacctgtacctgatgcactggccttatgcctttgagcgg
ggagacaaccccttccccaagaatgctgatgggactatatgctacgactccacccactac
aaggagacttggaaggctctggaggcactggtggctaaggggctggtgcaggcgctgggc
ctgtccaacttcaacagtcggcagattgatgacatactcagtgtggcctccgtgcgtcca
gctgtcttgcaggtggaatgccacccatacttggctcaaaacgagctaattgcccactgc
caagcacgtggcctggaggtaactgcttatagccctttgggctcctctgatcgtgcatgg
cgtgatcctgatgagcctgtcctgctggaggaaccagtagtcctggcattggctgaaaag
tatggccgatctccagctcagatcttgctcaggtggcaggtccagcggaaagtgatctgc
atccccaaaagtatcactccttctcgaatccttcagaacatcaaggtgtttgacttcacc
tttagcccagaagagatgaagcagctaaatgccctgaacaaaaattggagatatattgtg
cctatgcttacggtggatgggaagagagtcccaagggatgcagggcatcctctgtacccc
tttaatgacccgtactga

DBGET integrated database retrieval system