KEGG   Pan paniscus (bonobo): 100990760
Entry
100990760         CDS       T02283                                 

Gene name
IL10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04068  FoxO signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04660  T cell receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100990760 (IL10)
   04068 FoxO signaling pathway
    100990760 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100990760 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100990760 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100990760 (IL10)
   04660 T cell receptor signaling pathway
    100990760 (IL10)
   04672 Intestinal immune network for IgA production
    100990760 (IL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100990760 (IL10)
   05133 Pertussis
    100990760 (IL10)
   05150 Staphylococcus aureus infection
    100990760 (IL10)
   05152 Tuberculosis
    100990760 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100990760 (IL10)
   05144 Malaria
    100990760 (IL10)
   05145 Toxoplasmosis
    100990760 (IL10)
   05140 Leishmaniasis
    100990760 (IL10)
   05142 Chagas disease
    100990760 (IL10)
   05143 African trypanosomiasis
    100990760 (IL10)
  09163 Immune disease
   05310 Asthma
    100990760 (IL10)
   05322 Systemic lupus erythematosus
    100990760 (IL10)
   05320 Autoimmune thyroid disease
    100990760 (IL10)
   05321 Inflammatory bowel disease
    100990760 (IL10)
   05330 Allograft rejection
    100990760 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100990760 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100990760 (IL10)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100990760 (IL10)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Cytokines
   100990760 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ
Other DBs
NCBI-GeneID: 100990760
NCBI-ProteinID: XP_003822966
UniProt: A0A2R8ZE59
Position
1
AA seq 178 aa
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKVHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg
cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
caagacccagacatcaaggtgcatgtgaactccctgggggagaacctgaagaccctcagg
ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag
caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

DBGET integrated database retrieval system