KEGG   Pan paniscus (bonobo): 100991103
Entry
100991103         CDS       T02283                                 

Gene name
PYCARD
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05164  Influenza A
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100991103 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100991103 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    100991103 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    100991103 (PYCARD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100991103 (PYCARD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100991103 (PYCARD)
   05135 Yersinia infection
    100991103 (PYCARD)
   05133 Pertussis
    100991103 (PYCARD)
   05134 Legionellosis
    100991103 (PYCARD)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100991103 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN
Other DBs
NCBI-GeneID: 100991103
NCBI-ProteinID: XP_003807544
UniProt: A0A2R9CGD5
Position
16
AA seq 195 aa
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAEPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLEQS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggcgcgcgcgcgacgccatcctggatgcgctggagaacctgaccgccgaggagctc
aagaagttcaagctgaagctgctgtcggtgccgctgcgcgagggctacgggcgcatcccg
cggggcgcgctgctgtccatggacgccttggacctcaccgacaagctggttagcttctac
ctggagacctacggcgccgagctcaccgctaacgtgctgcgcgacatgggcctgcaggag
atggccgggcagctgcaggcggccacgcaccagggctctggagccgagccagctgggatc
caggcccctcctcagtcggcagccaagccaggcctgcactttatagaccagcaccgggct
gcgcttatcgcgagggtcacaaacgttgagtggctgctggatgccctgtacgggaaggtc
ctgacggatgagcagtaccaggcagtgcgggccgagcccaccaacccaagcaagatgcgg
aagctcttcagtttcacaccagcctggaactggacctgcaaggacttgctcctccaggcc
ctaagggagtcccagtcctacctggtggaggacctggagcagagctga

DBGET integrated database retrieval system