KEGG   Pan paniscus (bonobo): 100991249
Entry
100991249         CDS       T02283                                 

Gene name
IL5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04672  Intestinal immune network for IgA production
pps05200  Pathways in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100991249 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100991249 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100991249 (IL5)
   04660 T cell receptor signaling pathway
    100991249 (IL5)
   04658 Th1 and Th2 cell differentiation
    100991249 (IL5)
   04657 IL-17 signaling pathway
    100991249 (IL5)
   04664 Fc epsilon RI signaling pathway
    100991249 (IL5)
   04672 Intestinal immune network for IgA production
    100991249 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991249 (IL5)
  09163 Immune disease
   05310 Asthma
    100991249 (IL5)
   05320 Autoimmune thyroid disease
    100991249 (IL5)
   05321 Inflammatory bowel disease
    100991249 (IL5)
   05330 Allograft rejection
    100991249 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100991249 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100991249 (IL5)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100991249 (IL5)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Cytokines
   100991249 (IL5)
SSDB
Motif
Pfam: IL5 DUF6034
Other DBs
NCBI-GeneID: 100991249
NCBI-ProteinID: XP_003829353
UniProt: A0A2R9CIQ9
Position
5
AA seq 134 aa
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaggatgcttctgcatttgagtttgctagctcttggagctgcctacgtgtatgccatc
cccacagaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcat
cgaactctgctgatagccaatgagactctgaggattcctgttcctgtacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa
gggggtactgtggaaagactattcaaaaacttgtccttaataaagaaatacattgacggc
caaaaaaaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa
gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system