KEGG   Pan paniscus (bonobo): 100991366Help
Entry
100991366         CDS       T02283                                 

Gene name
PDHX
Definition
(RefSeq) pyruvate dehydrogenase complex component X
  KO
K13997  dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01100  Metabolic pathways
Module
pps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100991366 (PDHX)
   00020 Citrate cycle (TCA cycle)
    100991366 (PDHX)
   00620 Pyruvate metabolism
    100991366 (PDHX)
  09112 Not included in regular maps
   09113 Global maps only
    100991366 (PDHX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-GeneID: 100991366
NCBI-ProteinID: XP_003830422
UniProt: A0A2R9ACF8
Position
11
AA seq 501 aa AA seqDB search
MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFNSTQWLRGDPIKIL
MPSLSPTMEEGNIVKWLKKEGEVVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSK
NIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTL
RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPAAT
PTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPH
AYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPF
IDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL
GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDD
ELATRFLKSFKANLENPIRLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcctggaggctgggctgtgatccgcggctgctgcgttatcttgtgggcttc
cctggccgccgaagcgtagggctggtgaagggggctcttgggtggtctgtaagccgcgga
gctaattggagatggtttaacagcacgcagtggcttcggggtgatcccattaagatacta
atgccatcactgtctcctacaatggaagaaggaaacattgtgaaatggctgaaaaaggaa
ggtgaagtggtgagtgctggagatgcattatgtgaaattgagactgacaaagctgtggtt
accttagatgcaagtgatgatggaatcttggccaaaatcgtggttgaagaaggaagtaaa
aatatacggctaggttcactaattggtttgatagtagaagaaggagaagattggaaacat
gttgaaattcccaaagacgtaggtcctccaccaccagtttcaaaaccttcagagcctcgc
ccctcaccagaaccacagatttccatccctgtcaagaaggaacacatacccgggacacta
cggttccgtttaagtccagctgcccgcaatattctggaaaaacactcactggatgctagc
cagggcacagccactggccctcgggggatattcactaaagaggatgctctcaaacttgtc
cagttgaaacaaacgggcaagattaccgagtccagaccaactccagcccccgcagccact
cccacagcaccttcgcccctacaggccacagctggaccatcttatccccggcctgtgatc
ccaccagtatcaactcctggacaacccaatgcagtgggcacattcactgaaatccctgcc
agcaatattcgaagagttattgccaagagattaactgaatctaaaagtactgtacctcat
gcatatgctactgctgactgtgaccttggagctgttttaaaagttaggcaagatctggtc
aaagatgacattaaagtatcagtaaatgattttatcatcaaggcagcagctgttaccctt
aaacaaatgccagatgttaatgtaagctgggatggagagggcccaaagcaactgccattt
attgacatttcagtggctgtggcaacagataaaggcttacttactccaatcataaaagat
gctgctgctaaaggtatccaggaaattgctgactctgtaaaggctctatcaaagaaagca
agagatggaaaattgttgcctgaagaataccaaggaggatcttttagtatttccaacttg
gggatgtttggcatcgacgaatttactgcagtgattaaccctcctcaggcctgcattttg
gcggttgggaggttccgacctgtgctgaagctcactgaggatgaagagggaaatgccaaa
ctgcagcagcgccagctcataacagtcacaatgtcaagtgacagtcgagtggttgatgac
gaactggcaaccaggtttcttaaaagttttaaagcaaacctagagaatcctatccgactt
gcctag

DBGET integrated database retrieval system