KEGG   Pan paniscus (bonobo): 100991495
Entry
100991495         CDS       T02283                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04620  Toll-like receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04912  GnRH signaling pathway
pps04926  Relaxin signaling pathway
pps04935  Growth hormone synthesis, secretion and action
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05142  Chagas disease
pps05161  Hepatitis B
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100991495 (MAP2K4)
   04012 ErbB signaling pathway
    100991495 (MAP2K4)
   04668 TNF signaling pathway
    100991495 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100991495 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100991495 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100991495 (MAP2K4)
   04926 Relaxin signaling pathway
    100991495 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100991495 (MAP2K4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100991495 (MAP2K4)
   05161 Hepatitis B
    100991495 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100991495 (MAP2K4)
   05169 Epstein-Barr virus infection
    100991495 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100991495 (MAP2K4)
   05135 Yersinia infection
    100991495 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100991495 (MAP2K4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100991495 (MAP2K4)
   05418 Fluid shear stress and atherosclerosis
    100991495 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991495 (MAP2K4)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100991495 (MAP2K4)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: STE group
  STE7 family
   100991495 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal ABC1 Haspin_kinase APH Choline_kinase
Other DBs
NCBI-GeneID: 100991495
NCBI-ProteinID: XP_014197636
Position
17
AA seq 281 aa
MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICM
ELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLD
RSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLY
ELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKY
KELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 846 nt   +upstreamnt  +downstreamnt
atggtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggat
gaaaaagaacagaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgc
ccatacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatg
gaactcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgat
gttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccac
ttaaaagaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggac
agaagtggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctatt
gccaagacaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagc
gcatcacgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtat
gagttggccacaggccgatttccttatccaaagtggaatagtgtatttgatcaactaaca
caagtcgtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccg
agtttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtat
aaagagcttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgca
tgctatgtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtc
gattga

DBGET integrated database retrieval system