KEGG   Pan paniscus (bonobo): 100991501
Entry
100991501         CDS       T02283                                 

Gene name
PRDX4
Definition
(RefSeq) peroxiredoxin 4
  KO
K03386  peroxiredoxin 2/4 [EC:1.11.1.24]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100991501 (PRDX4)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     100991501 (PRDX4)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100991501 (PRDX4)
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin
Other DBs
NCBI-GeneID: 100991501
NCBI-ProteinID: XP_008971220
UniProt: A0A2R9BUT7
Position
X
AA seq 271 aa
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
NT seq 816 nt   +upstreamnt  +downstreamnt
atggaggcgctgccgctgctagccgcgacaactccggaccacggccgccaccgaaggctg
cttctgctgccgctactgctgttcctgctgccggctggagctgtgcagggctgggagaca
gaggagaggccccggactcgcgaagaggagtgccacttctacgcgggtggacaagtgtac
ccgggagaggcatcccgggtatcggtcgccgaccactccctgcacctaagcaaagcgaag
atttccaagccagcgccctactgggaaggaacagctgtgatcgatggagaatttaaggag
ctgaagttaactgattatcgtgggaaatacttggttttcttcttctacccacttgatttc
acatttgtgtgtccaactgaaattatcgcttttggcgacagacttgaagaattcagatct
ataaatactgaagtggtagcatgctctgttgattcacagtttacccatttggcctggatt
aatacccctcgaagacaaggaggacttgggccaataaggattccacttctttcagatttg
acccatcagatctcaaaggactatggtgtatacctagaggactcaggccacactcttaga
ggtctcttcattattgatgacaaaggaatcctgagacaaattactctgaatgatcttcct
gtgggtagatcagtggatgagacactacgtttggttcaagcattccagtacactgacaaa
cacggagaagtctgccctgctggctggaaacctggtagtgaaacaataatcccagatcca
gctggaaagctgaagtatttcgataaactgaattga

DBGET integrated database retrieval system