KEGG   Pan paniscus (bonobo): 100991536Help
Entry
100991536         CDS       T02283                                 

Gene name
C14H14orf80
Definition
(RefSeq) chromosome 14 open reading frame, human C14orf80
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4510 DUF4509
Motif
Other DBs
NCBI-GeneID: 100991536
NCBI-ProteinID: XP_003807026
UniProt: A0A2R9AGM8
Position
14
AA seq 426 aa AA seqDB search
MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEATSALWQLLFRV
LSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLAR
GPVPEQMLAQARVPLGDEMTVCQCEALASPGPPAPHMEAEGPVDVRHVQWLMGKLRFRWR
QLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQLLRTLERENQRL
EAVLAWRRSELVFWRWMDTVLGTCAPEVPAAASQPTFLPWVPERGGGELDLAVRELQALE
EELQEAVERRRVAWEAKAGGCGRGPEWSAARRASREAVEKELGALQQCWERDGGPAQPHG
PHRLVRREDGAAGDRDLRAAVVIRTLRSQEACLEAVLRRLQGQCRQELARLVGALPGLIW
IPPPGR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggggaggcggcggcagcgggtggaccccgcggctggggcccgggccggggccctgcct
gaggccatcgccgcgttgagtcggtcgctgccctcgggacccagccccgagatcttccgc
cgcgccaagttcgaccgtccggaggcgacctccgcgctctggcagctcctcttccgtgtg
ctctcgccactccctgcgggcaacgccttggcatcgctcgccctggaggtccaagcccgc
ttggtgaagtcagcactgtgttcccagggctacccgaggctggcactggcacaactacct
gaggatggctcgcagggcagtcgggagctgctgctggctctgtcctggctcttggcccga
ggacctgtgcccgagcagatgctggcccaggcccgagtgcctctgggtgacgagatgact
gtgtgccagtgtgaggccctggccagccctggcccacctgcaccccacatggaagcagaa
ggtcctgtggatgtccgccacgtgcagtggctgatgggaaagctgcggttccggtggcgc
cagctggtgtccagtcagcaggagcagtgcgccctcctgagcaagatccacctgtacaca
cgcggctgccacagcgaccagagccttagccatctgtctgtcactgaagcagagatgctc
agggacccagagggaggccagcagctgctgcggactctggagcgtgagaaccagcgcctg
gaggctgtcctggcgtggcggcgctctgagctggtcttctggcggtggatggacacggtc
ctgggcacctgtgccccggaggtgcctgctgcagcctcacagcccaccttcctgccctgg
gtccccgagcgcgggggtggcgagttggacctggcagtgcgggagctgcaggcactggag
gaggagctgcaggaggctgtggagcgcaggcgggtggcctgggaggccaaggctggaggc
tgtggacgggggccagagtggagtgccgcgcggcgggcctctcgggaggctgtggaaaag
gagctgggagctctacagcagtgctgggagcgagacggtggcccagcccagccccatggg
ccacaccggctggtgagacgagaggatggggcagcaggggaccgggacctgcgggcagct
gtggtgatcaggactctgaggagccaggaggcctgcctggaggcggtgctacgtcgacta
cagggacagtgtcggcaggaactggccaggctggtgggagccctgcctggtctcatctgg
atcccgccacctggacgctga

DBGET integrated database retrieval system