KEGG   Pan paniscus (bonobo): 100991584
Entry
100991584         CDS       T02283                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04066  HIF-1 signaling pathway
pps04911  Insulin secretion
pps04919  Thyroid hormone signaling pathway
pps04920  Adipocytokine signaling pathway
pps04922  Glucagon signaling pathway
pps04931  Insulin resistance
pps04976  Bile secretion
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05211  Renal cell carcinoma
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100991584 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100991584 (SLC2A1)
   04922 Glucagon signaling pathway
    100991584 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100991584 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100991584 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100991584 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991584 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100991584 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100991584 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100991584 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100991584 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100991584 (SLC2A1)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100991584 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100991584 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Other DBs
NCBI-GeneID: 100991584
NCBI-ProteinID: XP_003812908
UniProt: A0A2R9AVB9
Position
1
AA seq 492 aa
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatgggtccaccgctatggggagagcatcctgcccaccacg
ctcaccacgctctggtccctctcagtggccatcttttctgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtccgccgtgctcatgggcttctctaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgtcgtcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaacaaggacctgtggcccctgctgctgagcatcatcttcatcccggccctgctgcag
tgcatcgtgctgcccttctgccccgagagtccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctaaagaagctgcgcgggacagctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcccccgcctaccgccagcccatcctcatcgctgtggtgctgcagctg
tcccagcagctgtctggcatcaacgctgtcttctattactccacgagcatcttcgagaag
gcgggggtgcagcagcctgtgtatgccaccattggctccggtatcgtcaacacggccttc
actgtcgtgtcgctgtttgtggtggagcgagcaggccggcggaccctgcacctcataggc
ctcgctggcatggcgggttgtgccatactcatgaccatcgcgctggcactgctggagcag
ctaccctggatgtcctatctgagcatcgtggccatcttcggctttgtggccttctttgaa
gtgggtcctggccccatcccatggttcatcgtggctgaactcttcagccagggtccacgt
ccagctgccattgccgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcctgagactaaaggccggaccttc
gatgagatcgcttccggcttccggcaggggggagccagccaaagtgacaagacacccgag
gagctgttccatcccctgggggctgattcccaagtgtga

DBGET integrated database retrieval system