KEGG   Pan paniscus (bonobo): 100991637Help
Entry
100991637         CDS       T02283                                 

Gene name
VPS28
Definition
(RefSeq) VPS28, ESCRT-I subunit
  KO
K12184  ESCRT-I complex subunit VPS28
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100991637 (VPS28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100991637 (VPS28)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100991637 (VPS28)
Membrane trafficking [BR:pps04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    100991637 (VPS28)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100991637 (VPS28)
  Exosomal proteins of other body fluids (saliva and urine)
   100991637 (VPS28)
  Exosomal proteins of colorectal cancer cells
   100991637 (VPS28)
  Exosomal proteins of bladder cancer cells
   100991637 (VPS28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS28 RIG-I_C
Motif
Other DBs
NCBI-GeneID: 100991637
NCBI-ProteinID: XP_003819469
UniProt: A0A2R9CK01
Position
8
AA seq 221 aa AA seqDB search
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatgggatcccagccactccgggcataggagcccctgggaacaagccggagctg
tatgaggaagtgaagttgtacaagaacgcccgggagagggagaagtacgacaacatggca
gagctgtttgcggtggtgaagacaatgcaagccctggagaaggcctacatcaaggactgt
gtctcccccagcgagtacactgcagcctgctcccgactcctggtccaatacaaagctgcc
ttcaggcaggtccagggctcagaaatcagctctattgacgaattctgccgcaagttccgc
ctggactgcccgctggccatggagcggatcaaggaggaccggcccatcaccatcaaggac
gacaagggcaacctcaaccgctgcatcgcagacgtggtctcgctcttcatcacggtcatg
gacaagctgcgcctggagatccgcgccatggatgagatccagcccgacctgcgagagctg
atggagaccatgcaccgcatgagccacctcccacccgacttcgagggccgccagacggtc
agccagtggctgcagaccctgagcggcatgtcggcgtcagatgagctggacgactcacag
gtgcgtcagatgctgttcgacctggagtcagcctacaacgccttcaaccgcttcctgcat
gcctga

DBGET integrated database retrieval system