KEGG   Pan paniscus (bonobo): 100991644
Entry
100991644         CDS       T02283                                 

Gene name
FCGR2A
Definition
(RefSeq) Fc fragment of IgG receptor IIa
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04380  Osteoclast differentiation
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04666  Fc gamma R-mediated phagocytosis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05171  Coronavirus disease - COVID-19
pps05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100991644 (FCGR2A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100991644 (FCGR2A)
   04613 Neutrophil extracellular trap formation
    100991644 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    100991644 (FCGR2A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100991644 (FCGR2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100991644 (FCGR2A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100991644 (FCGR2A)
   05150 Staphylococcus aureus infection
    100991644 (FCGR2A)
   05152 Tuberculosis
    100991644 (FCGR2A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100991644 (FCGR2A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100991644 (FCGR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100991644 (FCGR2A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100991644 (FCGR2A)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    100991644 (FCGR2A)
CD molecules [BR:pps04090]
 Proteins
  100991644 (FCGR2A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set Ig_5 ECSCR V-set_CD47 DUF3827
Other DBs
NCBI-GeneID: 100991644
NCBI-ProteinID: XP_003804445
Position
Un
AA seq 317 aa
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCRGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPNFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQAPSVGSSSPVGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEEINNDYETADGGYMTLNPRAPTDDD
KNVYLTLPPNNHVNSNN
NT seq 954 nt   +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgcagctcccccaaag
gctgtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctg
acatgccggggggctcgcagccctgagagcgactccattcagtggttccacaatgggaat
ctcatccccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggg
gagtacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctt
tccgaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcgtg
ctgaggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatgga
aaatcccagaaattctcccatttggatcccaacttctccatcccacaagcaaaccacagt
cacagtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcct
gtgaccatcactgtccaagcgcccagcgtgggcagctcttcaccagtggggatcattgtg
gctgtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctac
tgcaggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgag
ccacctggacgtcaaatgattgccatcagaaagagacaacttgaagaaatcaacaatgac
tatgaaacagctgacggtggctacatgactctgaaccccagggcacctactgacgatgat
aaaaacgtctacctgactcttcctcccaacaaccatgtcaacagtaataactaa

DBGET integrated database retrieval system