KEGG   Pan paniscus (bonobo): 100991667Help
Entry
100991667         CDS       T02283                                 

Gene name
NAT1
Definition
(RefSeq) N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00232  Caffeine metabolism
pps00983  Drug metabolism - other enzymes
pps01100  Metabolic pathways
pps05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100991667 (NAT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100991667 (NAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100991667 (NAT1)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100991667 (NAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100991667
NCBI-ProteinID: XP_008975545
UniProt: A0A4P8J1D3
Position
8
AA seq 290 aa AA seqDB search
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGEAMDLGLEAIFDQVV
RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCIFRLTEENGFWYLDQIRREQYIPNEEFLNSDL
LEDSKYRKIYSFTLQPRTIEDFESMNTYLQTSPASVFTSKSFCSLQTPDGVHCLVGFTLT
HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLERKLVPKHGDRFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatatcttgaaagaattggctataaaaagtctaggaacaaattggac
ttggaaacattaactgacattcttcaacaccagatccgagctgttccctttgagaacctt
aacatccattgtggggaagccatggacttaggcttagaggccatttttgatcaagttgtg
agaagaaatcggggtggatggtgtctccaggtcaatcatcttctgtactgggctctgacc
actattggttttgagaccacaatgttgggaggttatgtttacagcactccagccaaaaaa
tacagcactggcatgattcaccttctcctgcaggtgaccattgatggcaggaactacatt
gtcgatgctgggtttggacgctcataccagatgtggcagcctctggagttaatttctggg
aaggatcagcctcaggtgccttgtatcttccgtttgacggaagagaatggattctggtat
ctagaccaaatcagaagggaacagtacattccaaatgaagaatttcttaattctgatctc
ctggaagacagcaaataccgaaaaatctactcctttactcttcagcctcgaacaattgaa
gattttgagtctatgaatacatacctgcagacatctccagcatctgtgtttactagtaaa
tcattttgttccttgcagaccccagatggggttcactgtttggtgggcttcaccctcacc
cataggagattcaattataaggacaatacagatctaatagagtttaagactctgagtgag
gaagaaatagaaaaagtgctgaaaaatatatttaatatatccttggagagaaagcttgtg
cccaaacatggtgatagattttttactatttag

DBGET integrated database retrieval system