KEGG   Pan paniscus (bonobo): 100991776
Entry
100991776         CDS       T02283                                 

Gene name
MYO1A
Definition
(RefSeq) myosin IA
  KO
K10356  myosin I
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100991776 (MYO1A)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100991776 (MYO1A)
   03036 Chromosome and associated proteins [BR:pps03036]
    100991776 (MYO1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100991776 (MYO1A)
   04147 Exosome [BR:pps04147]
    100991776 (MYO1A)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100991776 (MYO1A)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Others
    100991776 (MYO1A)
 Others
  Actin-binding proteins
   Myosins
    100991776 (MYO1A)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    100991776 (MYO1A)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100991776 (MYO1A)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100991776 (MYO1A)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ AAA_16 AAA_22
Other DBs
NCBI-GeneID: 100991776
NCBI-ProteinID: XP_003824942
UniProt: A0A2R9ATR0
Position
12
AA seq 1043 aa
MPLLEGSVGVEDLVLLEPLVEESLLKNLQLRYENKEIYTYIGNVVISVNPCQQLPIYGPE
FIAKYQDYTFYELKPHIYALANVAYQSLRDRDRDQCILITGESGSGKTEASKLVMSYVAA
VCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITN
YLLEKSRVVKQLKGERNFHIFYQLLAGADEQLLKALKLERDTTGYAYLNHEVSRVDGMDD
ASSFRAVQSAMAVIGFSEEEIRQVLEVTSMVLKLGNVLVADEFQANGIPASGIRDGRGVR
EIGEMVGLNSEEVERALCSRTMETAKEKVVTALNVMQAQYARDALAKNIYSRLFDWIVNR
INESIKVGIGEKKKVMGVLDIYGFEILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEEY
KREGIPWTKVDYFDNGIICKLIEHNQRGILAMLDEECLRPGVVSDSTFLAKLNQLFSKHG
HYESKVTQNAQRQYDHTMGLSCFRICHYAGKVTYNVTSFIDKNNDLLFRDLSQAMWKAQH
PLLRSLFPEGNPKQASLKRPPTAGAQFKSSVAILMKNLYSKSPNYIRCIKPNEHQQRGQF
SSDLVATQARYLGLLENVRVRRAGYAHRQGYGPFLERYRLLSRSTWPHWNGGDREGVEKV
LGELSMSSGELAFGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKIYRGWRCRTHYQLM
RKSQILISSWFRGNMQKKCYGKIKASVLLIQAFVRGWKARKNYRKYFRSEAALTLADFIY
KSMVQKFLLGLKNNLPSTNVLDKTWPAAPYKCLSTANQELQQLFYQWKCKRFRDQLSPKQ
VEILREKLCASELFKGKKASYPQSVPIPFCGDYIGLQGNPKLQKLKGGEEGPVLMAEAVK
KVNRGNGKTSSRILLLTKGHVILTDTKKSQAKIVIGLDNVAGVSVTSLKDGLFSLHLSEM
SSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGP
AGGDNSKLRYKKKGSHCLEVTVQ
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgcctctcctggaaggttctgtgggggtggaggatcttgtcctcctggaacccttggtg
gaggagtcactgctcaagaatcttcagcttcgctatgaaaacaaggagatttatacctac
attgggaatgtggtgatctcggtgaatccctgtcaacagcttcccatctatgggccagag
ttcattgccaaatatcaagactatactttctatgagctgaagccccatatctacgcattg
gcaaatgtggcgtaccagtcactgagggacagggaccgagaccagtgtatcctcatcaca
ggcgagagtggatccgggaagactgaggccagcaagctggtgatgtcttatgtggctgcc
gtctgtgggaaaggagagcaggtgaactctgtgaaggagcagctgctacagtctaaccca
gtgctggaggcttttggcaatgccaagaccattcgcaacaacaattcctcccgatttgga
aaatacatggatattgaatttgacttcaagggatcccccctcggtggtgtcatcacaaac
tatctgcttgagaaatcccgagtggtgaagcagctcaaaggagaaaggaacttccatatc
ttctatcagctgctggctggagcagatgaacagctgctgaaggccctgaagcttgagcgg
gatacaactggctatgcctatctgaatcatgaagtatccagggtggatggcatggacgac
gcctccagcttcagggctgtacagagtgcaatggcagtgattgggttctcggaggaggag
attcgacaagtgctagaggtgacatccatggtgctaaagctggggaacgtgttggtggct
gatgagttccaggccaatgggataccagcaagtggcatccgtgatgggagaggtgttcgg
gagattggggagatggtgggcttgaattcagaagaagtagagagagctttgtgctcgagg
accatggaaacagccaaggaaaaggtggtcactgcactgaatgttatgcaggctcagtat
gctcgggacgccctggctaagaacatctacagccgcctctttgactggatagtgaatcga
atcaatgagagcatcaaggtgggcatcggggaaaagaagaaggtaatgggagtccttgat
atctacggttttgagatattagaggataatagctttgagcaatttgtgatcaactactgc
aatgagaagctgcagcaggtgttcatagagatgaccctgaaagaagagcaagaggaatat
aagagagaaggcataccgtggacaaaggtggactactttgataatggcatcatttgtaag
ctcattgagcataatcagcgaggtatcctggccatgttggatgaggagtgcctgcggcct
ggggtggtcagtgactccactttcctagcaaagctgaaccagctcttctccaagcatggc
cactacgagagcaaagtcacccagaatgcccagcgtcagtatgaccacaccatgggcctc
agctgcttccgcatctgccactatgcgggcaaggtgacatacaacgtgaccagctttatt
gacaagaataatgacctactcttccgagacctgtcacaggccatgtggaaggcccagcac
cccctccttcggtccttgtttcctgagggcaatcctaagcaggcatctctcaaacgcccc
ccgactgctggggcccagttcaagagttctgtggccatcctcatgaagaatctgtattcc
aagagccccaactacatcaggtgcataaagcccaatgagcatcagcagcgaggtcagttc
tcttcagacctggtggcaacccaggctcggtacctgggactgctggagaacgtacgggtg
cgacgggcaggctatgcccaccgccagggttatgggcccttcctggaaaggtaccgattg
ctgagccggagcacctggcctcactggaatgggggagaccgggaaggtgttgagaaggtc
ctgggggagctgagcatgtcctcgggggagctggcctttggcaagacaaagatcttcatt
agaagccccaagactcttttctaccttgaagaacagaggcgcctgagactccagcagctg
gccacactcatacagaagatttaccgaggctggcgctgccgcacccactaccaactgatg
cgaaagagtcagatcctcatctcctcttggtttcggggaaacatgcaaaagaaatgctat
gggaagataaaggcatccgtgttattgatccaggcttttgtgagagggtggaaggcccga
aagaattatcgcaaatatttccggtcagaggctgccctcaccttggcagatttcatctac
aagagcatggtacagaaattcctactggggctgaagaacaatttgccatccacaaacgtc
ttagacaagacatggccagccgccccctacaagtgcctcagcacagcaaatcaggagctg
cagcagctcttctaccagtggaagtgcaagaggttccgggatcagctgtccccgaagcag
gtagagatcctgagggaaaagctctgtgccagtgaactgttcaagggcaagaaggcttca
tatccccagagtgtccccattccattctgtggtgactacattgggctgcaagggaacccc
aagctgcagaagctgaaaggcggggaggaggggcctgttctgatggcagaggccgtgaag
aaggtcaatcgtggcaatggcaagacttcttctcggattctcctcctgaccaagggccat
gtgattctcacagacaccaagaagtcccaggccaaaattgtcattgggctagacaatgtg
gctggggtgtcagtcaccagcctcaaggatgggctctttagcttgcatctgagtgagatg
tcatcggtgggctccaagggggacttcctgctggtcagcgagcatgtgattgaactgctg
accaaaatgtaccgggctgtgctggatgccacgcagaggcagcttacagtcaccgtgact
gagaagttctcagtgaggttcaaggagaacagtgtggctgtcaaggtcgtccagggccct
gcaggtggtgacaacagcaagctacgctacaaaaaaaaggggagtcattgcttggaggtg
actgtgcagtga

DBGET integrated database retrieval system