KEGG   Pan paniscus (bonobo): 100991779
Entry
100991779         CDS       T02283                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03050  Proteasome
pps04060  Cytokine-cytokine receptor interaction
pps04066  HIF-1 signaling pathway
pps04217  Necroptosis
pps04350  TGF-beta signaling pathway
pps04380  Osteoclast differentiation
pps04612  Antigen processing and presentation
pps04630  JAK-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05200  Pathways in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100991779 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100991779 (IFNG)
   04630 JAK-STAT signaling pathway
    100991779 (IFNG)
   04066 HIF-1 signaling pathway
    100991779 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100991779 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100991779 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100991779 (IFNG)
   04612 Antigen processing and presentation
    100991779 (IFNG)
   04660 T cell receptor signaling pathway
    100991779 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100991779 (IFNG)
   04659 Th17 cell differentiation
    100991779 (IFNG)
   04657 IL-17 signaling pathway
    100991779 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100991779 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991779 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100991779 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100991779 (IFNG)
   05164 Influenza A
    100991779 (IFNG)
   05168 Herpes simplex virus 1 infection
    100991779 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100991779 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100991779 (IFNG)
   05144 Malaria
    100991779 (IFNG)
   05145 Toxoplasmosis
    100991779 (IFNG)
   05140 Leishmaniasis
    100991779 (IFNG)
   05142 Chagas disease
    100991779 (IFNG)
   05143 African trypanosomiasis
    100991779 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100991779 (IFNG)
   05323 Rheumatoid arthritis
    100991779 (IFNG)
   05321 Inflammatory bowel disease
    100991779 (IFNG)
   05330 Allograft rejection
    100991779 (IFNG)
   05332 Graft-versus-host disease
    100991779 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100991779 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100991779 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:pps03051]
    100991779 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100991779 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100991779 (IFNG)
Proteasome [BR:pps03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100991779 (IFNG)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interferons
   100991779 (IFNG)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Cytokines
   100991779 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 Cna_B Tup_N
Other DBs
NCBI-GeneID: 100991779
NCBI-ProteinID: XP_003808753
UniProt: A0A2R9CC85
Position
12
AA seq 166 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtcattcagatgtagcagataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat
tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcgccagcagttaaaacggggaagcgaaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system