KEGG   Pan paniscus (bonobo): 100991905Help
Entry
100991905         CDS       T02283                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04520  Adherens junction
pps04910  Insulin signaling pathway
pps04913  Ovarian steroidogenesis
pps04923  Regulation of lipolysis in adipocytes
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps04960  Aldosterone-regulated sodium reabsorption
Module
pps_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100991905 (INSR)
   04015 Rap1 signaling pathway
    100991905 (INSR)
   04010 MAPK signaling pathway
    100991905 (INSR)
   04066 HIF-1 signaling pathway
    100991905 (INSR)
   04068 FoxO signaling pathway
    100991905 (INSR)
   04072 Phospholipase D signaling pathway
    100991905 (INSR)
   04022 cGMP - PKG signaling pathway
    100991905 (INSR)
   04151 PI3K-Akt signaling pathway
    100991905 (INSR)
   04152 AMPK signaling pathway
    100991905 (INSR)
   04150 mTOR signaling pathway
    100991905 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100991905 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100991905 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100991905 (INSR)
   04913 Ovarian Steroidogenesis
    100991905 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100991905 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100991905 (INSR)
   04213 Longevity regulating pathway - multiple species
    100991905 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100991905 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100991905 (INSR)
   04931 Insulin resistance
    100991905 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991905 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:pps04090]
    100991905 (INSR)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100991905 (INSR)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100991905 (INSR)
CD molecules [BR:pps04090]
 Proteins
  100991905 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100991905
NCBI-ProteinID: XP_008960641
Position
19
AA seq 1376 aa AA seqDB search
MRLLTCLAFCSFSLLVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSF
PKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMN
ITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPA
TVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNF
YLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSG
YTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLA
AELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQL
WDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENE
LLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTV
VDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTD
ATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGG
YLIHDLELIVYPRGIKGRRENGISFAQQSPGTKQGGSRGGDSPGTVADFACKELCPSILV
AVPEASLCPQRRWFCFHRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSST
SVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMP
EAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFA
LERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVF
LFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLL
RELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHV
VRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADG
MAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPE
SLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVT
DLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFLEVSFFHSEENKAPESEELEMEFEDMEN
VPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctcacctgtcttgctttctgttcattttctcttctagtgtgtcccggcatg
gatatccggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaagga
cacttgcagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttc
cccaaactcataatgatcactgattacttgctgctcttccgggtctatgggctcgagagc
ctgaaggacctgttccccaacctcacggtcatccggggatcacgactgttctttaactac
gcgctggtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaac
atcacgcggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatc
gactggtcccgtatcctggattccgtggaggataattacatcgtgttgaacaaagatgac
aacgaggagtgtggagacatctgtccgggtaccgcgaagggcaagaccaactgccccgcc
accgtcatcaacgggcagtttgtcgaacgatgttggactcacagtcactgccagaaagtt
tgcccgaccatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgag
tgcctgggcaactgttctcagcccgacgaccccaccaagtgcgtggcctgccgcaacttc
tacctggacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactgg
cgctgtgtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggagg
cagggctgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccggg
tacacgatgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtg
tgccacctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccga
ggatgcaccgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggca
gctgagctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgc
cgatcctacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagag
accttggaaatcgggaactactccttctatgccttggacaaccagaacctaaggcagctc
tgggattggagcaaacacaacctcaccatcactcaggggaaactctttttccactataac
cccaaactctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgc
caggagagaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgag
ttacttaaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccg
tactggccccccgacttccgagacctcttggggttcatgctgttctacaaagaggcccct
tatcaaaatgtgacggagttcgacgggcaggatgcatgtggttccaacagttggacggtg
gtagacattgacccacccctgaggtccaacgaccccaaatcacagaaccacccagggtgg
ctgatgcggggtctgaagccctggacccagtatgccatcttcgtgaagaccctggtcacc
ttttcggatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagat
gccaccaacccctccgtgcccctggatccaatctcagtgtctaactcatcatcccagatt
attttgaagtggaaacccccctccgaccccaatggcaacatcacccactacctggttttc
tgggagaggcaggcggaagacagtgagctgttcgaactggattattgcctcaaaggaggg
tacttgatacacgatttagagcttattgtctatcctcgaggcattaaggggaggagagaa
aatggaatttcctttgctcagcagtcaccaggcaccaagcagggtggcagcaggggaggt
gactctccagggactgttgcagattttgcttgtaaagagctgtgtccgtccatcttagtg
gctgtaccagaggcttccctctgtcctcaaaggcgttggttttgtttccacagaaaaacc
tcttcaggcactggtgccgaggaccctaggccatctcggaaacgcaggtcccttggcgat
gttgggaatgtgacggtggccgtgcccacggtggcagctttccccaacacttcctcgacc
agcgtgcccacgagtccggaggagcacaggccttttgagaaggtggtgaacaaggagtcg
ctggtcatctccggcttgcgacacttcacgggctatcgcatcgagctgcaggcttgcaac
caggacacccctgaggaacggtgcagtgtggcagcctacgtcagtgccaggaccatgcct
gaagccaaggctgatgacattgtcggccctgtgacgcatgaaatctttgagaacaacgtt
gtccacttgatgtggcaggagccgaaggagcccaatggtctgatcgtgctgtatgaagtg
agttatcggcgatatggtgatgaggagctgcatctctgcgtctcccgcaagcacttcgct
ctggagcggggctgcaggctgcgtgggctgtcaccggggaactacagcgtgcgagtccgg
gccacctcccttgcgggcaacggctcttggacggaacccacctatttctacgtgacagac
tatttagatgtcccgtcaaatattgcaaaaattatcatcggccccctcatctttgtcttt
ctcttcagtgttgtgattggaagtatttatctattcctgagaaagaggcagccagatggg
ccgctgggaccgctttacgcttcttcaaaccctgagtatctcagtgccagtgatgtgttt
ccatgctctgtgtacgtgccggacgagtgggaggtgcctcgagagaagatcaccctcctt
cgagagctggggcagggctccttcggcatggtgtatgagggcaatgccagggacatcatc
aagggtgaggcagagacccgcgtggcggtgaagacggtcaacgagtcagccagtctccga
gagcggattgagttcctcaatgaggcctcggtcatgaagggcttcacctgccatcatgtg
gtgcgcctcctgggagtggtgtccaagggccagcccacgctggtggtgatggagctgatg
gctcacggagacctgaagagctacctccgttctctgcggccagaggctgagaataatccc
ggccgccctccccctacccttcaagagatgattcagatggcggcagagattgctgacggg
atggcctacctgaacgccaagaagtttgtgcatcgggacctggcagcgagaaactgcatg
gtcgcccatgattttactgtcaaaattggagactttggaatgaccagagacatctatgaa
acggattactaccggaaagggggcaagggtctgctccctgtacggtggatggcgccagag
tccctgaaggatggggtcttcaccacttcttctgacatgtggtcctttggcgtggtcctt
tgggaaatcaccagcttggcagaacagccttaccaaggcctgtctaatgaacaggtgttg
aaatttgtcatggatggagggtatctggatcaacccgacaactgtccagagagagtcact
gacctcatgcgcatgtgctggcaattcaaccccaagatgaggccaaccttcctggagatt
gtcaacctgctcaaggacgacctgcaccccagctttctggaggtgtcgttcttccacagc
gaggagaacaaggctcccgagagcgaggagctggagatggagtttgaggacatggagaat
gtgcccctggaccgttcctcgcactgtcagagggaggaggcggggggccgggatggaggg
tcctcactaggtttcaagcggagctacgaggaacacatcccttacacacacatgaacgga
ggcaagaaaaacgggcggattctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system