KEGG   Pan paniscus (bonobo): 100992093
Entry
100992093         CDS       T02283                                 

Gene name
CD28
Definition
(RefSeq) CD28 molecule
  KO
K06470  CD28 antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04660  T cell receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05162  Measles
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100992093 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100992093 (CD28)
   04672 Intestinal immune network for IgA production
    100992093 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100992093 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100992093 (CD28)
   05323 Rheumatoid arthritis
    100992093 (CD28)
   05320 Autoimmune thyroid disease
    100992093 (CD28)
   05330 Allograft rejection
    100992093 (CD28)
   05332 Graft-versus-host disease
    100992093 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100992093 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100992093 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    100992093 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100992093 (CD28)
CD molecules [BR:pps04090]
 Proteins
  100992093 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 100992093
NCBI-ProteinID: XP_003820825
UniProt: A0A2R9B296
Position
2B
AA seq 220 aa
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgctcaggctgctcttggctctcaacttattcccttcaattcaagtaacaggaaacaag
attttggtgaagcagtcgcccatgcttgtagcgtacgacaatgcggtcaaccttagctgc
aagtattcctacaatctcttctcaagggagttccgggcatcccttcacaaaggactggat
agtgctgtggaagtctgtgttgtatatgggaattactcccagcagcttcaggtttactca
aaaacggggttcaactgtgatgggaaattgggaaatgaatcagtgacattctacctccag
aatttgtatgttaaccaaacagatatttacttctgcaaaattgaagttatgtaccctcct
ccttacctagacaatgagaagagcaatggaaccattatccatgtgaaagggaaacacctt
tgtccaagtcccctatttcccggaccttctaagcccttttgggtgctggtggtggttggt
ggagtcctggcttgctatagcttgctagtaacagtggcctttattattttctgggtgagg
agtaagaggagcaggctcctgcacagtgactacatgaacatgactccccgccgccctggg
cccacccgcaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcc
tga

DBGET integrated database retrieval system