KEGG   Pan paniscus (bonobo): 100992098Help
Entry
100992098         CDS       T02283                                 

Gene name
RAB2B
Definition
(RefSeq) RAB2B, member RAS oncogene family
  KO
K07878  Ras-related protein Rab-2B
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100992098 (RAB2B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100992098 (RAB2B)
Membrane trafficking [BR:pps04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    100992098 (RAB2B)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    100992098 (RAB2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3 AAA_24
Motif
Other DBs
NCBI-GeneID: 100992098
NCBI-ProteinID: XP_003804800
UniProt: A0A2R9B748
Position
14
AA seq 216 aa AA seqDB search
MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNK
SDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHN
EANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgcttatctcttcaagtatatcatcatcggagacacaggtgtggggaagtca
tgcctcctgctgcagtttacagataagcggttccagcctgtccacgacctcacaataggt
gtggagtttggagctcgtatggtcaacattgatggaaaacaaatcaaactgcaaatctgg
gatacggctgggcaagaatccttccgttctatcacccgttcctactacaggggagcagct
ggagcactgctggtgtacgacattacaaggcgtgaaaccttcaaccacctgacctcatgg
ttagaggatgcccggcagcactctagttccaacatggttatcatgctcattgggaataag
agtgacctagagtcccgcagggatgtgaagagagaagaaggagaggcctttgctagggag
catggacttatattcatggaaacttcagccaaaacagcctgcaatgttgaagaggccttc
attaacacagccaaagaaatatataggaagatccagcagggtttatttgatgtccacaat
gaggcaaatggcatcaagattgggccccaacagtcaatttcaacatcagtgggacccagt
gcctcccagcggaactctcgtgacatagggtccaactctggctgctgctga

DBGET integrated database retrieval system