KEGG   Pan paniscus (bonobo): 100992103
Entry
100992103         CDS       T02283                                 

Gene name
CBFA2T3
Definition
(RefSeq) CBFA2/RUNX1 translocation partner 3
  KO
K22752  CBFA2/RUNX1 translocation partner 3
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    100992103 (CBFA2T3)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND Efg1
Other DBs
NCBI-GeneID: 100992103
NCBI-ProteinID: XP_003805820
UniProt: A0A2R9ASZ4
Position
16
AA seq 653 aa
MPASRLRDRAAGSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKAS
AMPDSPAEVKTQPRSTPPSMPPPPPAASQGATRPPSFTPHTHREDGPATLPHGRFHGCLK
WSMVCLLMNGSSHSPTAINGAPSTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRF
LTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANL
PLLQRELLHCARLAKQTPAQYLAQHEQLLLDASASSPIDSSELLLEVNENGKRRTPDRTK
ENGSDRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHP
DPRELRERHRPLVVPGSRQEEVIDHKLTEREWAEEWKHLNNLLNCIMDMVEKTRRSLTVL
RRCQEADREELNHWARRYSDAEDTKKGPAPAAARPRSSSAGPEGPQLDVPREFLPRTLTG
YMPEDIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASE
DALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQGPA
AVGADPVPGPPEAAHSLGPSLPVGAASPSEAGSAGPSRPGSPSPPGPLDTVPR
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgccggcttcaagactgagggacagggcagctggttcagcctcgggatccacctgtggc
tccatgtcccagacgcaccctgtgctggagagcggcctcctggcatctgccggctgctcc
gcaccccggggtcccaggaagggcggcccagccccagtggacaggaaggctaaggcctca
gcgatgccggactccccagcggaggtgaagacgcagccccggtccacaccccccagcatg
ccgcccccaccgcctgccgcatcccagggggccacacgccccccctccttcacgccacac
acacatcgagaggacgggcctgcgacgctgccccacggccgttttcatggctgcttaaaa
tggtctatggtctgtctcttgatgaacggcagcagccactcgccaacagccatcaatggt
gcaccgtccacacccaacggcttcagcaatggcccggccacctcgtccacagcctccttg
tccacacagcacctgcccccggcctgcggggcccggcagctcagcaagctcaagcgcttc
ctcaccacactgcagcagtttggcagcgacatctccccagagattggggagcgcgtgcgc
acactggtgctgggcctggtgaactcaacactgacgatcgaggagtttcattccaagctt
caggaggccaccaacttccctctgcggccgtttgtcattcccttcctgaaggcaaacctg
cccttgctgcagcgggagctcttgcactgtgcacgcctggccaagcagacgcccgcccag
tacctggcccagcatgagcagctcctgctggacgccagcgcctcctcccccatcgactcc
tcagaactgctactggaagtcaacgagaacggcaagaggaggacgcccgacaggaccaaa
gagaacgggtcagaccgcgacccgctgcaccccgagcacctcagcaaacggccatgcacc
ctgaaccctgcccagcgctacagccccagcaacgggccaccgcagcccacaccgccgccg
cactaccgcctggaggacatagccatggcccaccacttccgagatgcctaccgccaccca
gatccccgggagctacgagagcgccatcggccgcttgtggtgcctgggtcccggcaggaa
gaagtgatcgaccacaagctcacagagcgtgagtgggcagaagagtggaagcacctcaac
aacctcctgaactgcatcatggacatggtggagaagacgcggcgctcgctcacggtgctg
cgcaggtgccaggaggccgaccgcgaggagctcaaccactgggcgcgacgctacagcgac
gccgaggacacaaagaagggccccgctcccgccgcggcccggccccgcagcagctccgcc
ggtcctgaagggcctcagctagacgtgcctcgcgagttcctgccgaggaccctcaccggc
tacatgcccgaggacatctggaggaaggctgaagaggccgtgaatgaggtgaagcggcag
gccatgtcggagctgcagaaagccgtgtcggacgcggagcgcaaagcgcacgagctcatc
accacggagcgtgccaagatggagcgggccctggccgaggcaaagcggcaggcctccgag
gacgccctgacggtcatcaaccagcaggaggactccagcgagagctgctggaactgcggg
cggaaagccagtgagacgtgcagcggctgcaacgcagcacgctactgcgggtccttctgc
cagcatcgggactgggagaagcatcaccacgtgtgtggccagagcctgcagggccccgcg
gccgtgggggccgacccggtgcctggaccgcccgaagccgcccacagcctgggcccctcc
ctgcctgtgggcgctgccagccccagcgaagccggctctgcggggccttctcgccccggc
tcccccagcccacctggcccactggacaccgtgccccgctga

DBGET integrated database retrieval system