KEGG   Pan paniscus (bonobo): 100992371
Entry
100992371         CDS       T02283                                 

Gene name
GSTM3
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00480  Glutathione metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps00983  Drug metabolism - other enzymes
pps01100  Metabolic pathways
pps01524  Platinum drug resistance
pps05200  Pathways in cancer
pps05204  Chemical carcinogenesis
pps05225  Hepatocellular carcinoma
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100992371 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100992371 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    100992371 (GSTM3)
   00983 Drug metabolism - other enzymes
    100992371 (GSTM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100992371 (GSTM3)
   05204 Chemical carcinogenesis
    100992371 (GSTM3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100992371 (GSTM3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100992371 (GSTM3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100992371 (GSTM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100992371 (GSTM3)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100992371 (GSTM3)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100992371 (GSTM3)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_6
Other DBs
NCBI-GeneID: 100992371
NCBI-ProteinID: XP_003810689
UniProt: A0A2R8ZY73
Position
1
AA seq 225 aa
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFFKMPINNKMAQWGNKPVC
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtcgtgcgagtcgtctatggttctcgggtactgggatattcgtgggctggcgcacgcc
atccgcctgctcctggagttcacggatacctcttatgaggagaaacggtacacgtgcggg
gaagctcctgactatgatcgaagccaatggctggatgtgaaattcaagctagacctggac
tttcctaatctgccctacctcctggatgggaagaacaagatcacccagagcaatgccatc
ttgcgctacatcgctcgcaagcacaacatgtgtggtgagactgaagaagaaaagattcga
gtggacatcatagagaaccaagtaatggatttccgcacacaactgataaggctctgttac
agctctgaccacgaaaaactgaagcctcagtacttggaagagctacctggacaactgaaa
caattctccatgtttctggggaaattctcatggtttgctggggaaaagctcacctttgtg
gattttctcacctatgatatcttggatcagaaccgtatatttgaccccaagtgcctggat
gagttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaaaatcgctgcc
tacttgcagtctgatcagttcttcaagatgcccatcaacaacaagatggcccagtggggc
aacaagcctgtatgctga

DBGET integrated database retrieval system