KEGG   Pan paniscus (bonobo): 100992465Help
Entry
100992465         CDS       T02283                                 

Gene name
CAV1
Definition
(RefSeq) caveolin 1
  KO
K06278  caveolin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04510  Focal adhesion
pps05100  Bacterial invasion of epithelial cells
pps05205  Proteoglycans in cancer
pps05416  Viral myocarditis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100992465 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100992465 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100992465 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100992465 (CAV1)
   05416 Viral myocarditis
    100992465 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100992465 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100992465 (CAV1)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100992465 (CAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 100992465
NCBI-ProteinID: XP_003808702
UniProt: A0A2R9BGE7
Position
7
AA seq 178 aa AA seqDB search
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgagctgagcgagaagcaa
gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac
gatgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
tttgacggcatttggaaggccagcttcaccaccttcactgtgacgaaatactggttttac
cgcttgctgtctgccctctttggcatcccgatggcactcatctggggcatttacttcgcc
attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt
gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatataa

DBGET integrated database retrieval system