KEGG   Pan paniscus (bonobo): 100992466
Entry
100992466         CDS       T02283                                 

Gene name
IL22
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04659  Th17 cell differentiation
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100992466 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100992466 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100992466 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100992466 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100992466 (IL22)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100992466 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 100992466
NCBI-ProteinID: XP_003808755
UniProt: A0A2R8ZS67
Position
12
AA seq 179 aa
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGENGEIKAIGELDLLFMSLRNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagctctttccttatggggaccctggccaccagctgc
ctccttctcttggccctcttggtacagggaggagcagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggagaaactgttc
cacggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgttccctcaatctgataggttccagccttatatgcaggaggtggtgccc
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaagctgaaggacacagtgaaaaagcttggagagaatggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

DBGET integrated database retrieval system