KEGG   Pan paniscus (bonobo): 100992507
Entry
100992507         CDS       T02283                                 

Gene name
CHRNA2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 2 subunit
  KO
K04804  nicotinic acetylcholine receptor alpha-2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100992507 (CHRNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100992507 (CHRNA2)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100992507 (CHRNA2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Atrophin-1
Other DBs
NCBI-GeneID: 100992507
NCBI-ProteinID: XP_003830852
UniProt: A0A2R9C9T0
Position
8
AA seq 529 aa
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPADFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSNCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGTLLGCVPRWLLMNRPPPPLELCHPLHLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgggcccctcctgtcctgtgttcctgtccttcacaaagctcagcctgtggtggctcctt
ctgaccccagcaggtggagaggaagctaagcgcccacctcccagggctcctggagaccca
ctctcctctcccagtcccacggcattgccgcagggaggctcgcataccgagactgaggac
cggctcttcaaacacctcttccggggctacaaccgctgggcgcgcccggtgcccaacact
tcagacgtggtgattgtgcgcttcggactgtccatcgctcagctcatcgatgtggatgag
aagaaccaaatgatgaccaccaacgtctggctaaaacaggagtggagcgactacaaactg
cgctggaaccccgctgattttggcaacatcacatctctcagggtcccttctgagatgatc
tggatccctgacattgttctctacaacaatgcagatggggagtttgcagtgacccacatg
accaaggcccacctcttctccacgggcactgtgcactgggtgcccccggccatctacaag
agctcctgcagtatcgacgtcaccttcttccccttcgaccagcagaactgcaagatgaag
tttggctcctggacttatgacaaggccaagatcgacctggagcagatggagcagactgtg
gacctgaaggactactgggagagcggcgagtgggccatcgtcaatgccacgggcacctac
aacagcaagaagtacgactgctgcgccgagatctaccccgacgtcacctacgccttcatc
atccggcggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcc
tgcctcactgtgctggtcttctacctgccctccaactgcggcgagaagatcacgctgtgc
atttcggtgctgctgtcactcaccgtcttcctgctgctcatcactgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctgctgttcaccatgatcttcgtcacc
ctgtccattgtcatcaccgtcttcgtgctcaatgtgcaccaccgctcccccagcacccac
accatgccccactgggtgcgggggacccttctgggctgtgtgccccggtggcttctgatg
aaccggcccccaccacccttggagctctgccaccccctacacctgaagctcagcccctct
tatcactggctggagagcaacgtggatgccgaggagagggaggtggtggtggaggaggag
gacagatgggcatgtgcaggtcatgtggccccctctgtgggcaccctctgcagccacggc
cacctgcactctggggcctcaggtcccaaggctgaggctctgctgcaggagggtgagctg
ctgctatcaccccacatgcagaaggcactggaaggtgtgcactacattgccgaccacctg
cggtctgaggatgccgactcttcggtgaaggaggactggaagtatgttgccatggtcatc
gacaggatcttcctctggctgtttatcatcgtctgcttcctggggaccatcggcctcttt
ctgcctccattcctagctggaatgatctaa

DBGET integrated database retrieval system