KEGG   Pan paniscus (bonobo): 100992567
Entry
100992567         CDS       T02283                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04115  p53 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04370  VEGF signaling pathway
pps04919  Thyroid hormone signaling pathway
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05134  Legionellosis
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05215  Prostate cancer
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100992567 (CASP9)
   04151 PI3K-Akt signaling pathway
    100992567 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100992567 (CASP9)
   04215 Apoptosis - multiple species
    100992567 (CASP9)
   04115 p53 signaling pathway
    100992567 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100992567 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100992567 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100992567 (CASP9)
   05212 Pancreatic cancer
    100992567 (CASP9)
   05215 Prostate cancer
    100992567 (CASP9)
   05213 Endometrial cancer
    100992567 (CASP9)
   05222 Small cell lung cancer
    100992567 (CASP9)
   05223 Non-small cell lung cancer
    100992567 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100992567 (CASP9)
   05161 Hepatitis B
    100992567 (CASP9)
   05160 Hepatitis C
    100992567 (CASP9)
   05164 Influenza A
    100992567 (CASP9)
   05162 Measles
    100992567 (CASP9)
   05168 Herpes simplex virus 1 infection
    100992567 (CASP9)
   05163 Human cytomegalovirus infection
    100992567 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100992567 (CASP9)
   05169 Epstein-Barr virus infection
    100992567 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100992567 (CASP9)
   05152 Tuberculosis
    100992567 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100992567 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100992567 (CASP9)
   05012 Parkinson disease
    100992567 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100992567 (CASP9)
   05016 Huntington disease
    100992567 (CASP9)
   05020 Prion disease
    100992567 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100992567 (CASP9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100992567 (CASP9)
   05416 Viral myocarditis
    100992567 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100992567 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100992567 (CASP9)
   01002 Peptidases and inhibitors [BR:pps01002]
    100992567 (CASP9)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100992567 (CASP9)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100992567 (CASP9)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100992567 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 AsiA
Other DBs
NCBI-GeneID: 100992567
NCBI-ProteinID: XP_003806305
UniProt: A0A2R9CHF2
Position
1
AA seq 416 aa
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKEMVLALLELARQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggacgaagcggatcggcggctcctgcggcggtgccggctgcggctggtggaagagctg
caggtggaccagctctgggacgccctgctgagccgcgagctgttcaggccccatatgatc
gaggacatccagcgggcaggctctggatctcggcgggatcaggccaggcagctgatcata
gatctggagactcgagggagtcaggctcttcctttgttcatctcctgcttagaggacaca
ggccaggacatgctggcttcgtttctgcgaactaacaggcaagcagcaaagttgtcgaag
ccaaccctagaaaaccttaccccagtggtgctcagaccagagattcgcaaaccagaggtt
ctcagaccggaaacacccagaccagtggacattggttctggaggattcggtgatgtcggt
gctcttgagagtttgaggggaaatgcagatttggcttacatcctgagcatggagccctgt
ggccactgcctcattatcaacaatgtgaacttctgccgtgagtccgggctccgcacccgc
actggctccaacatcgactgtgagaagttgcggcgtcgcttctcctcgctgcatttcatg
gtggaggtgaagggcgacctgactgccaaggaaatggtgctggctttgctggagctggcg
cggcaggaccacggtgctctggactgctgcgtggtggtcattctctctcatggctgtcag
gccagccacctgcagttcccaggggctgtctacggcacagatggatgccctgtgtcggtc
gagaagattgtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaag
ctctttttcatccaggcctgtggtggggagcagaaagaccatgggtttgaggtggcctcc
acttcccctgaagacgagtcccctggcagtaaccccgagccagacgccaccccgttccag
gaaggtttgaggaccttcgaccagctggacgccatatctagtttgcccacacccagtgac
atctttgtgtcctactctactttcccaggttttgtttcctggagggaccccaaaagtggc
tcctggtacgttgagaccctggacgacatctttgagcagtgggctcactctgaagacctg
cagtccctcctgcttagggtcgctaatgctgtttcggtgaaagggatttataaacagatg
cctggttgctttaatttccttcggaaaaaacttttctttaaaacatcataa

DBGET integrated database retrieval system