KEGG   Pan paniscus (bonobo): 100992692
Entry
100992692         CDS       T02283                                 

Gene name
CCNB1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04114  Oocyte meiosis
pps04115  p53 signaling pathway
pps04218  Cellular senescence
pps04914  Progesterone-mediated oocyte maturation
pps05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100992692 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100992692 (CCNB1)
   04114 Oocyte meiosis
    100992692 (CCNB1)
   04115 p53 signaling pathway
    100992692 (CCNB1)
   04218 Cellular senescence
    100992692 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100992692 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100992692 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pps03032]
    100992692 (CCNB1)
   03036 Chromosome and associated proteins [BR:pps03036]
    100992692 (CCNB1)
DNA replication proteins [BR:pps03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100992692 (CCNB1)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100992692 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Adeno_E1A Trypan_PARP TonB_N
Other DBs
NCBI-GeneID: 100992692
NCBI-ProteinID: XP_003806839
UniProt: A0A2R9CK63
Position
5
AA seq 433 aa
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTPSPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
AIVQDLAKAVAKV
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaactcgaaaattaatgctgaaaataaggcgaagatcaac
atggcaggcgcaaagcgcgttcctacggcccctgctgcaacctccaagcccggactgagg
ccaagaacagctcttggggacattggtaacaaagtcagtgaacaactgcaggccaaaatg
cctatgaagaaggaagcaaaaccttcagctactggaaaagtcattgataaaaaactacca
aaacctcttgaaaaggtacctatgctggtgccagtgccagtgtctgagccagtgccagag
ccagaacctgagccagaacctgagcctgttaaagaagaaaaactttcgcctgagcctatt
ttggttgatactccctctccaagcccaatggaaacatctggatgtgcccctgcagaagaa
gacctgtgtcaggctttctctgatgtaattcttgcagtaaatgatgtggatgcagaagat
ggagctgatccaaacctttgtagtgaatatgtgaaagatatttatgcttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaatacctactgggtcgggaagtcactggaaac
atgagagccatcctaattgactggctagtacaggttcaaatgaaattcaggttgttgcag
gagaccatgtacatgactgtctccattattgatcggttcatgcagaataattgtgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttattgcaagcaaatatgaagaa
atgtaccctccagaaattggtgactttgcttttgtgactgacaacacttatactaagcac
caaatcagacagatggaaatgaagattctaagagctttaaactttggtctgggtcggcct
ctacctttgcacttccttcggagagcatctaagattggagaggttgatgtcgagcaacat
actttggccaaatacctgatggaactaactatgttggactatgacatggtgcactttcct
ccttctcaaattgcagcaggagctttttgcttagcactgaaaattctggataatggtgaa
tggacaccaactctacaacattacctgtcatatactgaagaatctcttcttccagttatg
cagcacctggctaagaatgtagtcatggtaaatcaaggacttacaaagcacatgactgtc
aagaacaagtatgccacatcgaagcatgctaagatcagcactctaccacagctgaattct
gcaatagttcaagatttagccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system