KEGG   Pan paniscus (bonobo): 100992817Help
Entry
100992817         CDS       T02283                                 

Gene name
MDM1
Definition
(RefSeq) Mdm1 nuclear protein
  KO
K17886  nuclear protein MDM1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    100992817 (MDM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MDM1
Motif
Other DBs
NCBI-GeneID: 100992817
NCBI-ProteinID: XP_003808756
UniProt: A0A2R9AKK3
Position
12
AA seq 714 aa AA seqDB search
MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQLGITKEPSFISKRRVPY
HDPQISKSLEWNGAISESNVVASPEPEAPETPKSQEAEQKDVTQERVHSLEASRVPKRTR
SHSADSRAEGASDVENNEGVTNHTPVNENVELEHSTKVLSENVANGLDRLLRKKAGLTVV
PSYNALRNSEYQRQFVWKTSKESAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKRNFKG
LSPVKEPKLRNDLRENRNLETVSPERKSNKIDDHLKLEAEMELKDLHQPKRKLTPWKHQR
LGKVNSEYRAKFLSPAQYLYKAGAWTHVKGNMPNQVKELREKAEFYRKRVQGTHFSRDHL
NQILSDSNCCWDVSSTTSSEGTVSSNIRALDLAGDPTSHKTLQKCPSTEPEEKGNIVEEQ
PQKNTTEKLGVSAPTIPVRRRLAWDTENTSEDVQKQPGEKEEEDDDEEEGDRKTGKQAFM
GEQEKSDVHEKSKADKMKEGSDSSVSSEKGGRLPTPKLRELGGIQRTHHDLTTPAVGGAV
LVSPSRMKPPAPEQRKRMTSQDCLETSKNDFTKKEGRAVSLLTSPAAGIKTVDPLPLRED
SEDNIHKFAEATLPVSKIPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHNVGK
ARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTLARAKKRKENFWGKT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcgcttcaaggggctgagtgaataccagaggaacttcctgtggaaaaagtct
tatttgtcagagtcttgtaattcctccgtggggcgaaagtacccatgggctggacttaga
tcagatcaattaggcatcacgaaagagccaagttttatttcaaaaagaagagtcccttac
catgacccacagatttcaaaatctctggagtggaatggagctatctcagagagcaatgtg
gttgcatcaccagaaccagaagccccggaaacaccaaaatcacaagaagcagaacaaaag
gatgttactcaagaaagagttcactcactagaagcttccagggttcccaaaagaaccaga
tctcactctgcagactccagagctgaaggggcttcagatgtggaaaataatgagggtgta
acaaaccatacaccagttaatgaaaatgtggaactggaacattctaccaaggttctttca
gaaaatgtagctaatgggttggatagacttctgcgtaagaaagctggattgactgttgtt
ccttcatataatgccttgagaaattctgaatatcaaaggcagtttgtttggaagacttct
aaagaaagtgctccagcttttgcagccaatcaggttttccacaataaaagccagtttgtt
ccaccattcaaaggtaactcagtcatccatgaaactgaatacaaaagaaatttcaagggt
ttatctccagtgaaagaaccaaaattaagaaatgatttgagagaaaacagaaatcttgaa
acagtgtctcctgaaaggaagagtaataaaatagatgatcatttaaaattggaagcagag
atggaattaaaagacttacaccagcctaaaaggaagcttactccttggaaacatcaaagg
cttgggaaggtgaattccgaatatagagcaaaatttctgagcccagctcagtatttatat
aaagctggggcttggacacatgtaaagggaaacatgccaaatcaggttaaagaactccga
gaaaaggctgagttttataggaagcgagttcaggggacgcatttttctcgggaccatctg
aatcagattttatctgatagcaactgctgttgggatgtctcctcaaccacaagctcagaa
ggaaccgttagtagcaacatcagagcattagatcttgctggagatcctacaagccataag
actttgcagaaatgtccttctacagaaccagaagaaaaaggaaatatcgtggaagaacag
ccccagaaaaataccacggagaaattgggtgtgtcagctcccaccatacccgttagaagg
cggctggcttgggatacagagaacacaagtgaagacgtacagaaacagcccggggagaaa
gaggaggaggacgacgatgaagaggaaggggacaggaaaacgggcaagcaggcttttatg
ggagagcaagagaagtcggatgtacatgagaaatctaaggcagataagatgaaagaaggg
tcagattcttctgtatcctcagaaaaaggaggccggcttcctactcccaagctgagagaa
cttggtggaatccagaggactcatcatgatctcactactccagctgttggtggtgctgtt
ttagtgtctccatctaggatgaagcctccagccccagaacagaggaaaagaatgacctct
caggattgtttagaaacttcaaagaatgattttactaagaaagaaggtcgtgctgtatcc
ctactgacttctccagctgctggtataaaaacagttgatcctctgcctttgcgggaagat
tctgaagacaatatccacaaatttgctgaggcaactcttccagtttcaaaaattccaaaa
tacccaacaaatccccctggacagttgccttctccaccacatgttccatcctactggcat
ccctctcgacgaattcagggctctcttagagatccagagtttcagcacaatgtgggaaaa
gcaaggatgaacaatttgcagttacctcaacatgaagcctttaatgatgaagatgaggac
agattgtctgagatttctgctcgctctgcagcttctagtctccgggcttttcaaactctg
gcacgagctaagaaaaggaaggagaatttctggggtaaaacataa

DBGET integrated database retrieval system