KEGG   Pan paniscus (bonobo): 100992951
Entry
100992951         CDS       T02283                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04071  Sphingolipid signaling pathway
pps04115  p53 signaling pathway
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04261  Adrenergic signaling in cardiomyocytes
pps04340  Hedgehog signaling pathway
pps04510  Focal adhesion
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04722  Neurotrophin signaling pathway
pps04725  Cholinergic synapse
pps04915  Estrogen signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05215  Prostate cancer
pps05222  Small cell lung cancer
pps05226  Gastric cancer
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100992951 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100992951 (BCL2)
   04630 JAK-STAT signaling pathway
    100992951 (BCL2)
   04064 NF-kappa B signaling pathway
    100992951 (BCL2)
   04066 HIF-1 signaling pathway
    100992951 (BCL2)
   04071 Sphingolipid signaling pathway
    100992951 (BCL2)
   04151 PI3K-Akt signaling pathway
    100992951 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100992951 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100992951 (BCL2)
   04215 Apoptosis - multiple species
    100992951 (BCL2)
   04217 Necroptosis
    100992951 (BCL2)
   04115 p53 signaling pathway
    100992951 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100992951 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100992951 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100992951 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100992951 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100992951 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100992951 (BCL2)
   04722 Neurotrophin signaling pathway
    100992951 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100992951 (BCL2)
   05206 MicroRNAs in cancer
    100992951 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100992951 (BCL2)
   05226 Gastric cancer
    100992951 (BCL2)
   05215 Prostate cancer
    100992951 (BCL2)
   05222 Small cell lung cancer
    100992951 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100992951 (BCL2)
   05161 Hepatitis B
    100992951 (BCL2)
   05162 Measles
    100992951 (BCL2)
   05168 Herpes simplex virus 1 infection
    100992951 (BCL2)
   05169 Epstein-Barr virus infection
    100992951 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100992951 (BCL2)
   05152 Tuberculosis
    100992951 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100992951 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100992951 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100992951 (BCL2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100992951 (BCL2)
   05418 Fluid shear stress and atherosclerosis
    100992951 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100992951 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100992951 (BCL2)
   01524 Platinum drug resistance
    100992951 (BCL2)
   01522 Endocrine resistance
    100992951 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100992951 (BCL2)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100992951 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100992951
NCBI-ProteinID: XP_008950955
Position
18
AA seq 192 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPSPVPPVVHLTLRQAGDDFSRR
YRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVG
ACITLGAYLGHK
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccagc
ccggtgccacctgtggtccacctgaccctccgccaggccggcgacgacttctcccgccgc
taccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgcgg
ggacgctttgccacggtggtggaggagctcttcagggacggggtgaactgggggaggatt
gtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcg
cccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcacctgcacacc
tggatccaggataacggaggctgggatgcctttgtggaactgtacggccccagcatgcgg
cctctgtttgatttctcctggctgtctctgaagactctgctcagtttggccctggtggga
gcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system