KEGG   Pan paniscus (bonobo): 100992984
Entry
100992984         CDS       T02283                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04620  Toll-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04657  IL-17 signaling pathway
pps04668  TNF signaling pathway
pps05160  Hepatitis C
pps05164  Influenza A
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100992984 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100992984 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100992984 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100992984 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    100992984 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    100992984 (CXCL10)
   04657 IL-17 signaling pathway
    100992984 (CXCL10)
   04062 Chemokine signaling pathway
    100992984 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100992984 (CXCL10)
   05171 Coronavirus disease - COVID-19
    100992984 (CXCL10)
   05164 Influenza A
    100992984 (CXCL10)
   05169 Epstein-Barr virus infection
    100992984 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100992984 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100992984 (CXCL10)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100992984 (CXCL10)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100992984 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100992984
NCBI-ProteinID: XP_003832346
UniProt: A0A2R9BLR2
Position
4
AA seq 96 aa
MNQTAILICCLIFLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEI
IATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaatcaaactgccattctgatttgctgccttatctttctaagtggcattcaaggagta
cctctctctagaactgtacgctgtacctgcatcagcattagtaatcaacctgttaatcca
aggtctttagaaaaacttgaaattattcctgcaagtcaattttgtccacgtgttgagatc
attgctacaatgaaaaagaagggtgagaagagatgtctgaatccagaatcgaaggccatc
aagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa

DBGET integrated database retrieval system