KEGG   Pan paniscus (bonobo): 100993018
Entry
100993018         CDS       T02283                                 

Gene name
CTLA4
Definition
(RefSeq) cytotoxic T-lymphocyte associated protein 4
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04660  T cell receptor signaling pathway
pps05320  Autoimmune thyroid disease
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100993018 (CTLA4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100993018 (CTLA4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100993018 (CTLA4)
   05320 Autoimmune thyroid disease
    100993018 (CTLA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100993018 (CTLA4)
CD molecules [BR:pps04090]
 Proteins
  100993018 (CTLA4)
SSDB
Motif
Pfam: V-set V-set_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 100993018
NCBI-ProteinID: XP_003820827
UniProt: A0A2R9CI29
Position
2B
AA seq 223 aa
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcttgccttggatttcagcggcacaaggctcagctgaacctggctaccaggacctgg
ccctgcactctcctgttttttcttctcttcatccctgtcttctgcaaagcaatgcacgtg
gcccagcctgctgtggtgctggccagcagccgaggcatcgccagctttgtgtgtgagtat
gcatctccaggcaaagccactgaggtccgggtgacagtgcttcggcaggccgacagccag
gtgactgaagtctgtgcggcaacctacatgatggggaatgagttgaccttcctagatgat
tccatctgcacgggcacctccagtggaaatcaagtgaacctcactatccaaggactgagg
gccatggacacgggactctacatctgcaaggtggagctcatgtacccaccgccatactac
ctgggcataggcaacggaacccagatttatgtaattgatccagaaccgtgcccagattct
gacttcctcctctggatccttgcagcagttagttcggggttgtttttttatagctttctc
ctcacagctgtttctttgagcaaaatgctaaagaaaagaagccctcttacaacaggggtc
tatgtgaaaatgcccccaacagagccagaatgtgaaaagcaatttcagccttattttatt
cccatcaattga

DBGET integrated database retrieval system