KEGG   Pan paniscus (bonobo): 100993098Help
Entry
100993098         CDS       T02283                                 

Gene name
CA11
Definition
(RefSeq) carbonic anhydrase 11
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 100993098
NCBI-ProteinID: XP_003814132
UniProt: A0A2R9A1F0
Position
19
AA seq 328 aa AA seqDB search
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNG
LAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGVPHGR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggggctgcagctcgtctgagcgcccctcgagcgctggtactctgggctgcactgggg
gcagcagctcacatcggaccagcacctgaccccgaggactggtggagctacaaggataat
ctccagggaaacttcgtgccagggcctcctttctggggcctggtgaatgcagcgtggagt
ctgtgtgctgtggggaagcggcagagccccgtggatgtggagctgaagagggttctttat
gacccctttctgcccccattaaggctcagcactggaggagagaagctccggggaaccttg
tacaacaccggccgacatgtctccttcctgcctgcaccccgacctgtggtcaatgtgtct
ggaggtcccctcctttatagccaccgactcagtgaactgcggctgctgtttggagctcgc
gacggagccggctcggaacatcagatcaaccaccagggcttctctgctgaggtgcagctc
attcacttcaaccaggaactctacgggaatttcagcgctgcctcccgcggccccaatggc
ctggccattctcagcctctttgtcaacgttgccagtacctctaacccattcctcagtcgc
ctccttaaccgcgacaccatcactcgcatctcctacaagaatgatgcctactttcttcaa
gacctgagcctggagctcctgttccctgaatccttcggcttcatcacctatcagggctct
ctcagcaccccgccctgctccgagactgtcacctggatcctcattgaccgggccctcaat
atcacctcccttcagatgcactccctgagactcctgagccagaatcctccatctcagatc
ttccagagcctcagcggtaacagccggcccctgcagcccttggcccacagggcactgagg
ggcaacagggacccccggcaccccgagaggcgctgccgaggccccaactaccgcctgcat
gtggatggtgtcccccatggtcgctga

DBGET integrated database retrieval system