KEGG   Pan paniscus (bonobo): 100993375
Entry
100993375         CDS       T02283                                 

Gene name
ICOS
Definition
(RefSeq) inducible T-cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04660  T cell receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100993375 (ICOS)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100993375 (ICOS)
   04672 Intestinal immune network for IgA production
    100993375 (ICOS)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100993375 (ICOS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100993375 (ICOS)
CD molecules [BR:pps04090]
 Proteins
  100993375 (ICOS)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 100993375
NCBI-ProteinID: XP_003820828
UniProt: A0A2R9BIK8
Position
2B
AA seq 199 aa
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
MFMRAVNTAKKSRLTDVTL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaagtcaggcctctggtatttctttctcttctgcttgcgcattaaagttttaacagga
gaaatcaatggttctgccaattatgagatgtttatatttcacaacggaggtgtacaaata
ttatgcaaatatcctgacattgtccagcaatttaaaatgcagttgctgaaaggggggcaa
atactctgcgatctcactaagacaaaaggaagtggaaacacagtatccattaagagtctg
aaattctgccattctcagttatccaacaacagtgtctctttttttctatacaacttggac
cgttctcatgccaactattacttctgcaacctatcaatttttgatcctcctccttttaaa
gtaactcttacgggaggatatttgcatatttatgaatcacaactttgttgccaactgaag
ttctggttacccataggatgtgcagcctttgttgtagtctgcattttgggatgcatactt
atttgttggcttacaaaaaagaagtattcatccagtgtgcatgaccctaacggtgaatac
atgttcatgagagcagtgaacacagccaaaaaatctagactcacagatgtgaccctataa

DBGET integrated database retrieval system