KEGG   Pan paniscus (bonobo): 100993613
Entry
100993613         CDS       T02283                                 

Gene name
IL1B
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01523  Antifolate resistance
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04064  NF-kappa B signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04640  Hematopoietic cell lineage
pps04657  IL-17 signaling pathway
pps04659  Th17 cell differentiation
pps04668  TNF signaling pathway
pps04750  Inflammatory mediator regulation of TRP channels
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04940  Type I diabetes mellitus
pps05010  Alzheimer disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
pps05332  Graft-versus-host disease
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100993613 (IL1B)
   04064 NF-kappa B signaling pathway
    100993613 (IL1B)
   04668 TNF signaling pathway
    100993613 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100993613 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100993613 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100993613 (IL1B)
   04620 Toll-like receptor signaling pathway
    100993613 (IL1B)
   04621 NOD-like receptor signaling pathway
    100993613 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    100993613 (IL1B)
   04625 C-type lectin receptor signaling pathway
    100993613 (IL1B)
   04659 Th17 cell differentiation
    100993613 (IL1B)
   04657 IL-17 signaling pathway
    100993613 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100993613 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100993613 (IL1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100993613 (IL1B)
   05164 Influenza A
    100993613 (IL1B)
   05162 Measles
    100993613 (IL1B)
   05168 Herpes simplex virus 1 infection
    100993613 (IL1B)
   05163 Human cytomegalovirus infection
    100993613 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100993613 (IL1B)
   05135 Yersinia infection
    100993613 (IL1B)
   05133 Pertussis
    100993613 (IL1B)
   05134 Legionellosis
    100993613 (IL1B)
   05152 Tuberculosis
    100993613 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100993613 (IL1B)
   05144 Malaria
    100993613 (IL1B)
   05140 Leishmaniasis
    100993613 (IL1B)
   05142 Chagas disease
    100993613 (IL1B)
   05143 African trypanosomiasis
    100993613 (IL1B)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100993613 (IL1B)
   05321 Inflammatory bowel disease
    100993613 (IL1B)
   05332 Graft-versus-host disease
    100993613 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100993613 (IL1B)
   05020 Prion disease
    100993613 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    100993613 (IL1B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100993613 (IL1B)
   05418 Fluid shear stress and atherosclerosis
    100993613 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100993613 (IL1B)
   04932 Non-alcoholic fatty liver disease
    100993613 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100993613 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100993613 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100993613 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100993613 (IL1B)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100993613 (IL1B)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Cytokines
   100993613 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 100993613
NCBI-ProteinID: XP_003804551
UniProt: A0A2R9BYV3
Position
2A
AA seq 269 aa
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAVSVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWENEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcagaagtacctgaactcgccagtgaaatgatggcttattacagtggcaatgaggat
gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac
ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc
ttcaggcaggccgtgtcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcttcgacacatgggaaaacgaggcttatgtgcacgatgcacctgtacga
tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa
aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa

KEGG   Pan paniscus (bonobo): 100994286
Entry
100994286         CDS       T02283                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04217  Necroptosis
pps04218  Cellular senescence
pps04380  Osteoclast differentiation
pps04640  Hematopoietic cell lineage
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04940  Type I diabetes mellitus
pps05010  Alzheimer disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05133  Pertussis
pps05140  Leishmaniasis
pps05152  Tuberculosis
pps05162  Measles
pps05164  Influenza A
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
pps05332  Graft-versus-host disease
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100994286 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100994286 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100994286 (IL1A)
   04218 Cellular senescence
    100994286 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100994286 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100994286 (IL1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100994286 (IL1A)
   05162 Measles
    100994286 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100994286 (IL1A)
   05152 Tuberculosis
    100994286 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100994286 (IL1A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100994286 (IL1A)
   05321 Inflammatory bowel disease
    100994286 (IL1A)
   05332 Graft-versus-host disease
    100994286 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100994286 (IL1A)
   05020 Prion disease
    100994286 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100994286 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100994286 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100994286 (IL1A)
   04932 Non-alcoholic fatty liver disease
    100994286 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100994286 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100994286 (IL1A)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100994286 (IL1A)
SSDB
Motif
Pfam: IL1_propep IL1
Other DBs
NCBI-GeneID: 100994286
NCBI-ProteinID: XP_003804552
UniProt: A0A2R9AMR9
Position
2A
AA seq 271 aa
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa
gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat
ggcccactccatgaaggctgcatggatcaatctgtgtctctgagtatctctgaaacctct
aaaacatccaagcttaccttcaaggagagcatggtggtagtagcgaccaacgggaaggtt
ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctggaggccatc
gccaatgactcagaggaagaaatcatcaagcctaggtcagcaccttttagcttcctgagc
aatgtgaaatacaactttatgaggatcatcaaatacgaattcatcctgaatgacgccctc
aatcaaagtataattcgagccaatgatcagtacctcacggctgctgcattacataatctg
gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt
accgtgattctaagaatctcaaaaactcaattgtatgtgactgcccaagatgaagaccaa
ccagtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgagaccaac
ctcctcttcttctgggaaactcacggcactaagaactatttcacatcagttgcccatcca
aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct
atcactgactttcagatactggaaaaccaggcttag

DBGET integrated database retrieval system