KEGG   Pan paniscus (bonobo): 100993737Help
Entry
100993737         CDS       T02283                                 

Gene name
FAM72A
Definition
(RefSeq) family with sequence similarity 72 member A
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM72
Motif
Other DBs
NCBI-GeneID: 100993737
NCBI-ProteinID: XP_003822976
UniProt: A0A2R8ZB43
Position
1
AA seq 149 aa AA seqDB search
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
VTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGV
NVLLWGNLPEIEESTDEDVLNISAEECIR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaacatttgtagtttcaaggacaggtgcgtgtccatcctgtgttgcaaattc
tgtaaacaagtgctcagctctaggggaatgaaggctgttttgctggctgatactgaaata
gaccttttctctacagacatccctcctaccaacgcagtggacttcactggaagatgctat
gtcaccaaaatctgcaaatgtaaactgaaggacatcgcatgtttaaaatgtgggaacatt
gtaggttatcatgtgattgttccatgtagttcctgtcttctttcctgcaacaacggacac
ttctggatgtttcacagccaggcagtttatgatattaacagactagactccacaggtgta
aacgtcctactttggggcaacttgccagagatagaagagagtacagatgaagatgtgtta
aatatctcagcagaggagtgtattagataa

DBGET integrated database retrieval system