KEGG   Pan paniscus (bonobo): 100994281
Entry
100994281         CDS       T02283                                 

Gene name
ENO2
Definition
(RefSeq) enolase 2
  KO
K01689  enolase [EC:4.2.1.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps01230  Biosynthesis of amino acids
pps03018  RNA degradation
pps04066  HIF-1 signaling pathway
Module
pps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pps_M00002  Glycolysis, core module involving three-carbon compounds
pps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100994281 (ENO2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100994281 (ENO2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100994281 (ENO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pps03019]
    100994281 (ENO2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100994281 (ENO2)
Enzymes [BR:pps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     100994281 (ENO2)
Messenger RNA biogenesis [BR:pps03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100994281 (ENO2)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100994281 (ENO2)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 100994281
NCBI-ProteinID: XP_008971910
UniProt: A0A2R9C6K1
Position
12
AA seq 434 aa
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK
AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI
VIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtccatagagaagatctgggcccgggagatcctggactcccgcgggaaccccacagtg
gaggtggatctctatactgccaaaggtcttttccgggctgcagtgcccagtggagcctct
acgggcatctatgaggccctggagctgagggatggagacaaacagcgttacttaggcaaa
ggtgtcctgaaggcagtggaccacatcaactccaccatcgcgccagccctcatcagctca
ggtctctctgtggtggagcaagagaaactggacaacctgatgctggagttggatgggact
gagaacaaatccaagtttggggccaatgccatcctgggtgtgtctctggccgtgtgtaag
gcaggggcagctgagcgggaactgcccctgtatcgccacattgctcagctggctgggaac
tcagacctcatcctgcctgtgccggccttcaatgtgatcaatggtggctctcatgctggc
aacaagctggccatgcaggagttcatgatcctcccagtgggagctgagagctttcgggat
gccatgcgactaggtgcagaggtctaccatacactcaagggagtcatcaaggacaaatac
ggcaaggatgccaccaatgtgggggatgaaggtggctttgcccccaatatcctggagaac
agtgaagccttggagctggtgaaggaagccatcgacaaggctggctacacggaaaagatc
gtcattggcatggatgttgctgcctcagagttttatcgtgatggcaaatatgacttggac
ttcaagtctcccactgatccttcccgatacatcactggggaccagctgggggcactctac
caggactttgtcagggactatcctgtggtctccattgaggacccatttgaccaggatgat
tgggctgcctggtccaagttcacagccaatgtagggatccagattgtgggtgatgacctg
acagtgaccaacccaaaacgtattgagcgggcagtggaagaaaaggcctgcaactgtctg
ctgctcaaggtcaaccagatcggctcggtcactgaagccatccaagcgtgcaagctggcc
caggagaatggctggggggtcatggtgagtcatcgctcaggagagactgaggacacattc
attgctgacctggtggtggggctgtgcacaggccagatcaagactggtgccccgtgccgt
tctgaacgtctggctaaatacaaccagctcatgagaattgaggaagagctgggggatgaa
gctcgctttgccggacataacttccgtaatcccagtgtgctgtga

DBGET integrated database retrieval system