KEGG   Pan paniscus (bonobo): 100994583Help
Entry
100994583         CDS       T02283                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta 1
  KO
K05636  laminin, beta 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04512  ECM-receptor interaction
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100994583 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100994583 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100994583 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100994583 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100994583 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100994583 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100994583 (LAMB1)
   05145 Toxoplasmosis
    100994583 (LAMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 100994583
NCBI-ProteinID: XP_003811258
UniProt: A0A2R9A2B3
Position
7
AA seq 1786 aa AA seqDB search
MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGISIVERQYIQDRIPSWTGAGFVQVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPGGCKPCECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LRQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGYLFEEAEKLIKDV
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctccagttgctagctttcagtttcttagccctgtgcagagcccgagtgcgc
gctcaggaacccgagttcagctacggctgcgcagaaggcagctgctatcccgccacgggc
gaccttctcatcggccgagcacagaagctttcggtgacctcgacgtgcgggctgcacaag
cccgaaccctactgtatcgtcagccacttgcaggaggacaaaaaatgcttcatatgcaat
tcccaagatccttatcatgagaccctgaatcctgacagccatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccagctgctatgctgatagaacgatcgtccgactttgggaaaacctgg
ggtgtgtatagatacttcgcctatgactgcgaggcctcgtttccaggcatttcaactggc
cccatgaaaaaagtcgatgacataatttgtgattcccgatattctgacattgaaccctca
actgaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agcccaaggatacagaatttattaaaaattaccaacttgagaatcaagtttgtgaaactg
catactttgggagataaccttctggattccaggatggaaatcagagaaaagtattattat
gcagtttatgatatggtggttcgaggaaattgcttctgctatggtcatgccagcgaatgt
gcccctgtggatggattcaatgaagaagtggaaggaatggttcacggacactgcatgtgc
aggcataacaccaagggcttaaactgtgaactctgcatggatttctaccatgatttacct
tggagacctgctgaaggccgaaacagcaatgcctgtaaaaaatgtaactgcaatgaacat
tccatctcatgtcactttgacatggctgtttacctggccacggggaacgtcagcggaggc
gtgtgtgatgactgtcagcacaacaccatggggcgcaactgtgagcagtgcaagccgttt
tactaccagcacccagagagggacatccgagatcctaatttctgtgaacgatgtacgtgt
gacccagctggctctcaaaatgagggaatttgtgacagctatactgatttttctactggt
ctcattgctggccagtgtcggtgtaaattaaatgtggaaggagaacattgtgatgtttgc
aaagaaggcttctatgatttaagcagtgaagatccatttggttgtaaatcttgtgcttgc
aatcctctgggaacaattcctggagggaatccttgtgattccgagacaggtcactgctac
tgcaagcgtctggtgacaggacagcattgtgaccagtgcctgccagagcactggggctta
agcaatgatttggatggatgtcgaccatgtgactgtgaccttgggggagccttaaacaac
agttgctttgcggagtcaggccagtgctcatgtcggcctcacatgatcggacgtcagtgc
aacgaagtggaacctggttactactttgccaccctggatcactacctctatgaagcggag
gaagccaacttggggcctgggattagcatagtggagcggcaatatatccaggaccggatt
ccctcctggactggagccggcttcgtccaagtgcctgaaggggcttatttggagtttttc
attgacaacataccatattccatggagtacgacatcctaattcgctacgagccacagcta
cccgaccactgggaaaaagctgtcatcacagtgcagcgacctggaaggattccaaccagc
agccgatgtggtaataccatccccgatgatgacaaccaggtggtgtcattatcaccaggc
tcaagatatgtcgtccttcctcggccggtgtgctttgagaagggaacaaactacacggtg
aggttggagctgcctcagtacacctcctctgatagcgacgtggagagcccctacacgctg
atcgattctcttgttctcatgccatactgtaaatcactggacatcttcaccgtgggaggt
tcaggagatggggtggtcaccaacagtgcctgggaaacctttcagagataccgatgtcta
gagaacagcagaagcgttgtgaaaacaccgatgacagatgtttgcagaaacatcatcttt
agcatttctgccctgttacaccagacaggcctggcttgtgaatgcgaccctcagggttcg
ttaagttccgtgtgtgatcccaacggaggccagtgccagtgccggcccaacgtggttgga
agaacctgcaacagatgtgcacctggaacttttggctttggccccggtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgccttctgcaatcccgtcactggccagtgc
cactgtttccagggagtgtatgctcggcagtgtgatcggtgcttacctgggcactggggc
tttccaagttgccagccctgccagtgcaatggccacgccgatgactgcgacccagtgact
ggggagtgcttgaactgccaggactacaccatgggtcataactgtgaaaggtgcttggct
ggttactatggcgaccccatcattgggtcaggagatcactgccgcccttgcccttgccca
gatggtcccgacagtggacgccagtttgccaggagctgctaccaagatcctgttacttta
cagcttgcctgtgtttgtgatcctggatacattggttccagatgtgacgactgtgcctca
ggatactttggcaatccatcagaagttggggggtcgtgtcagccttgccagtgtcacaac
aacattgacacgacagacccagaagcctgtgacaaggagactgggaggtgtctcaagtgc
ctgtaccacacggaaggggaacactgtcagttctgccggtttggatactatggtgacgcc
ctccggcaggactgtcgaaagtgtgtctgtaattacctgggcaccgtgcaagagcactgt
aacggctctgactgccagtgcgacaaagccactggtcagtgcttgtgtcttcctaatgtg
atcgggcagaactgtgaccgctgtgcgcccaatacctggcagctggccagtggcacaggc
tgtgacccatgcaactgcaatgctgctcattccttcgggccgtcttgcaatgagttcacg
gggcagtgccagtgcatgcctgggtttggaggccgcacctgcagcgagtgccaggaactc
ttctggggagaccccgatgtggagtgccgagcctgtgactgtgaccccaggggcattgag
acgccacagtgtgaccagtccacgggccagtgtgtctgcgttgagggtgttgagggtcca
cgctgtgacaagtgcacgcgagggtactcgggggtcttccctgactgcacaccctgccac
cagtgctttgctctctgggatgtgatcattgccgagctgaccaacaggacacacagattc
ctggagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgtgagactgtg
gactcggtggaaaggaaagtcagcgagataaaagacatcctggcgcagagccccgcagca
gagccactgaaaaacattgggtatctctttgaggaagcagagaaactgattaaagatgtt
acagaaatgatggctcaagtagaagtgaaattatctgacacaacttcccaaagcaacagc
acagccaaagaactggattctctacagacagaagccgaaagcctagacaacactgtgaaa
gaacttgctgaacaactggaatttatcaaaaactcagatattcggggtgccttggatagc
attaccaagtatttccagatgtctcttgaggcagaggagagagtgaatgcctccaccaca
gaacccaacagcactgtggagcagtcagccctcatgagagacagagtagaagacgtgatg
atggagcgagaatcccagttcaaggaaaaacaagaggagcaggctcgcctccttgatgaa
ctggcaggcaagctacaaagcctagacctttcagccgctgctgaaatgacctgtggaaca
cccccaggggcctcctgttccgagactgaatgtggcgggccaaactgcagaactgacgaa
ggagagaagaagtgtggggggcctggctgtggtggtctggttactgttgcacacaacgcc
tggcagaaagccatggacttggaccaagatgtcctgagtgccctggctgaagtggaacag
ctctccaagatggtctctgaagcaaaactgagggcagatgaggcaaaacagagtgctgaa
gacattctgttgaagacaaatgctaccaaagaaaaaatggacaagagcaatgaggagctg
agaaatctaatcaagcaaatcagaaactttttgacccaggatagtgctgatttggacagc
attgaagcagttgctaatgaagtattgaaaatggagatgcctagcaccccacagcagtta
cagaacttgacagaagatatacgtgaacgagttgaaagcctttctcaagtagaggttatt
cttcagcatagtgctgctgacattgccagagctgagatgttgttagaagaagctaaaaga
gcaagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagctctggaa
gaagcagaaaaggcccaggtcgcagcagagaaggcaattaaacaagcagatgaagacatt
caaggaacccagaacctgctaacttcgattgagtctgaaacagcagcttctgaggaaacc
ttgttcaacgcgtcccagcgcatcagcgagttagagaggaatgtggaagaacttaagcgg
aaagctgcccaaaactccggggaggcagaatatattgaaaaagtagtatatactgtgaag
caaagtgcagaagatgttaagaagactttagatggtgaacttgatgaaaagtataaaaaa
gtagaaaatttaattgccaaaaaaactgaagagtcagctgatgccagaaggaaagctgaa
atgctacaaaatgaagcaaaaactcttttagctcaagcaaatagcaagctgcaactgctc
aaagatttagaaagaaaatatgaagacaatcaaagatacttagaagataaagctcaagaa
ttagcgagactggaaggagaagtccgttcactcctgaaggatataagccagaaagttgct
gtgtatagcacatgcttgtaa

DBGET integrated database retrieval system