KEGG   Pan paniscus (bonobo): 100994584
Entry
100994584         CDS       T02283                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04672  Intestinal immune network for IgA production
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100994584 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100994584 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100994584 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100994584 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100994584 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100994584 (IL15RA)
   04090 CD molecules [BR:pps04090]
    100994584 (IL15RA)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IL2 receptor family
   100994584 (IL15RA)
CD molecules [BR:pps04090]
 Proteins
  100994584 (IL15RA)
SSDB
Motif
Pfam: RamS
Other DBs
NCBI-GeneID: 100994584
NCBI-ProteinID: XP_003827842
Position
10
AA seq 231 aa
MSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD
PALVHQRPAPPSTVTTAGMTPQPESLSPSGKEPAASSPSSNTTAATTAAIVPGSQLMPSK
SPSTGTTEIGSHESSHGTPSQTTAKTWELTASASHQPPGVYPQGHSDTTVAISTSTVLLC
GLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTGGTSSRDEDLENCSHHL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgtccgtggaacacgcagacatctgggtcaagagctacagcttgtactccagggagcgg
tacatttgtaactctggtttcaagcgtaaagccggcacgtccagcctgacggagtgcgtg
ttgaacaaggccacgaatgtcgcccactggacaacccccagtctcaaatgcattagagac
cctgccctggttcaccaaaggccagcgccaccctccacagtaacgacggcagggatgacc
ccacagccagagagcctctccccttctggaaaagagcccgcagcttcatctcccagctca
aacaccacagcggccacaacagcagctattgtcccgggctcccagctgatgccttcaaaa
tcaccttccacaggaaccacagagataggcagtcatgagtcctcccacggcaccccctct
cagacaacagccaagacctgggaactcacagcatctgcctcccaccagccgccaggtgtg
tatccacagggccacagcgacaccactgtggctatctccacgtccactgtcctgctgtgt
gggctgagcgctgtgtctctcctggcatgctacctcaagtcaaggcaaactcccccgctg
gccagcgttgaaatggaagccatggaggctctgccggtgactggggggaccagcagcaga
gatgaagacttggaaaactgctctcaccacctatga

DBGET integrated database retrieval system