KEGG   Pan paniscus (bonobo): 100994768
Entry
100994768         CDS       T02283                                 

Gene name
TLR2
Definition
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps05132  Salmonella infection
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05205  Proteoglycans in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100994768 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100994768 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100994768 (TLR2)
   04620 Toll-like receptor signaling pathway
    100994768 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100994768 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100994768 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100994768 (TLR2)
   05161 Hepatitis B
    100994768 (TLR2)
   05171 Coronavirus disease - COVID-19
    100994768 (TLR2)
   05162 Measles
    100994768 (TLR2)
   05168 Herpes simplex virus 1 infection
    100994768 (TLR2)
   05169 Epstein-Barr virus infection
    100994768 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100994768 (TLR2)
   05134 Legionellosis
    100994768 (TLR2)
   05152 Tuberculosis
    100994768 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100994768 (TLR2)
   05144 Malaria
    100994768 (TLR2)
   05145 Toxoplasmosis
    100994768 (TLR2)
   05140 Leishmaniasis
    100994768 (TLR2)
   05142 Chagas disease
    100994768 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100994768 (TLR2)
   05321 Inflammatory bowel disease
    100994768 (TLR2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100994768 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100994768 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100994768 (TLR2)
   04054 Pattern recognition receptors [BR:pps04054]
    100994768 (TLR2)
   04090 CD molecules [BR:pps04090]
    100994768 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100994768 (TLR2)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100994768 (TLR2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100994768 (TLR2)
Pattern recognition receptors [BR:pps04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100994768 (TLR2)
CD molecules [BR:pps04090]
 Proteins
  100994768 (TLR2)
Glycosaminoglycan binding proteins [BR:pps00536]
 Hyaluronan
  Cell surface receptors
   100994768 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_5 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 100994768
NCBI-ProteinID: NP_001266165
UniProt: B3Y614
Position
4
AA seq 784 aa
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYESKSLKSIQNVSHLILHMKQHILLLEIFVDVSSSVECLELRDTDLDTFRFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLIVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNVDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgccacatactttgtggatggtgtgggtcttgggggtcatcatcagcctctccaaggaa
gaatcctccaatcaggcttctctgtcttgtgaccgcaatggtatctgcaagggcagctca
ggatctttaaactccattccctcagggctcacagaagctgtaaaaagccttgacctgtcc
aacaacaggatcacctacattagcaacagtgacctacagaggtgtgtgaacctccaggct
ctggtgctgacatccaatggaattaacacaatagaggaagattctttttcttccctgggc
agtcttgaacatttagacttatcctataattacttatctaatttatcatcttcctggttc
aagcccctttcttctttaacattcttaaacttactgggaaatccttacaaaaccctaggg
gaaacatctcttttttctcatctcacaaaattgcaaatcctgagagtgggaaatatggac
accttcactaagattcaaagaaaagattttgctggacttaccttccttgaggaacttgag
attgatgcttcagatctacagagctatgagtcaaaaagtttgaagtcaattcagaacgta
agtcatctgatccttcatatgaagcagcatattttactgctggagatttttgtagatgtt
tcaagttccgtggaatgtttggaactacgagatactgatttggacactttccgtttttca
gaactatccactggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaa
atcaccgatgaaagtttgtttcaggttatgaaacttttgaatcagatttctggattgtta
gaattagagtttgatgactgtacccttaatggagttggtaattttagagcatctgataat
gacagagttatagatccaggtaaagtggaaacgttaacaatccggaggctgcatattcca
aggttttacttattttatgatctgagcactttatattcacttacagaaagagttaaaaga
atcacagtagaaaacagtaaagtttttctggttccttgtttactttcacagcatttaaaa
tcattagaatacttggatctcagtgaaaatttgatagttgaagaatacttgaaaaattca
gcctgtgaggatgcctggccctctctacaaactttaattttaaggcaaaatcatttggca
tcattggaaaaaaccggagagactttgctcactctgaaaaacttgactaacgttgatatc
agtaagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatat
ttgaacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaa
attttagatgttagcaacaacaatctcaatttattttctttgaatttgccgcaactcaaa
gaactttatatttccagaaataagttgatgactctaccagatgcctccctcttacccatg
ttactagtattgaaaatcagtaggaatgcaataactacgttttctaaggagcaacttgac
tcatttcacacactgaagactttggaagctggtggcaataacttcatttgctcctgtgaa
ttcctctccttcactcaggagcagcaagcactggccaaagtcttgattgattggccagca
aattacctgtgtgactctccatcccatgtgcgcggccagcaggttcaggatgtccgcctc
tcggtgtcggaatgtcacaggacagcactggtgtctggcatgtgctgtgctctgttcctg
ctgatcctgctcacgggggtcctgtgccaccgttttcatggcctgtggtatatgaaaatg
atgtgggcctggctccaggccaaaaggaagcccaggaaagctcccagcaggaacatctgc
tatgatgcatttgtttcttacagtgagcgggatgcctactgggtggagaaccttatggtc
caggagctggagaacttcaatccccccttcaagttgtgtcttcataagcgggacttcatt
cctggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtc
tttgtgctttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcc
catttccgtctttttgatgagaacaatgatgctgccattctcattcttctggagcccatt
gagaaaaaagccattccccagcgcttctgcaagctgcggaagataatgaacaccaagacc
tacctggagtggcccatggacgaggctcagcgggaaggattttgggtaaatctgagagct
gcgataaagtcctag

DBGET integrated database retrieval system