KEGG   Pan paniscus (bonobo): 100994862
Entry
100994862         CDS       T02283                                 

Gene name
PTDSS2
Definition
(RefSeq) phosphatidylserine synthase 2
  KO
K08730  phosphatidylserine synthase 2 [EC:2.7.8.29]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00564  Glycerophospholipid metabolism
pps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100994862 (PTDSS2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.29  L-serine-phosphatidylethanolamine phosphatidyltransferase
     100994862 (PTDSS2)
SSDB
Motif
Pfam: PSS TctB
Other DBs
NCBI-GeneID: 100994862
NCBI-ProteinID: XP_003806046
UniProt: A0A2R8ZU87
Position
11
AA seq 487 aa
MRRGERRDAGGPRPESPVPAGKASLEEPPDGSSAGQATGPGEGRRSTESEVYDDGTNTFF
WRAHTLTVLFILTCTLGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRP
HPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPD
NETDPFHNIWDKLDGFVPAHFLGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSE
CWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWNIPTYKGKIKRIAFQFTPYSW
VRFEWKPASSLRRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGV
AMREIYDFMDDPKPHKKLGPQAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGS
VLVLTWTVWRFFLRDITLRYKETRWQKWQNKDDQGSTVGNGDQHPPGLDEDLLGPGVAEG
EGAPTPN
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgcggaggggcgagcgcagggacgccgggggtccgcggcccgagtccccggtgcccgcg
ggcaaggcctcgctggaggagccgcctgacgggtcgtctgccggccaagccaccgggccg
ggcgagggccgccgcagcaccgagtccgaggtctacgacgacggcaccaacaccttcttc
tggcgagcccacaccttaaccgtgctcttcatcctcacctgtacgcttggctacgtgacg
ctgctggaggaaacacctcaggacacggcctacaacaccaagagaggtattgtggccagt
attttggttttcttatgttttggagtcacacaagccaaagacgggccattttccagacct
catccagcttactggaggttttggctctgcgtgagtgtggtctacgagctgtttctcatc
tttatactcttccagactgtccaggacggccggcagtttctaaagtatgttgaccccaag
ctgggagtcccactgccagagagagactacgggggaaactgcctcatctacgacccagac
aatgagactgacccctttcacaacatctgggacaagttggatggctttgttcccgcacac
tttcttggctggtacctgaagaccctgatgatccgagactggtggatgtgcatgatcatc
agcgtgatgttcgagttcctggagtacagcctggagcaccagctgcccaacttcagcgag
tgctggtgggatcactggatcatggacgtgctcgtctgcaacgggctgggcatctactgc
ggcatgaagacccttgagtggctgtccctgaagacatacaagtggcagggcctctggaac
attccgacctacaagggcaagataaagaggatcgccttccagttcacgccgtacagctgg
gttcgcttcgagtggaagccggcctccagcctgcgtcgctggctggccgtgtgcggcatc
atcctggtgttcctgttggcagaactgaacacgttctacctgaagtttgtgctgtggatg
cccccggagcactacctggtcctcctgcggctcgtcttcttcgtgaacgtgggtggcgtg
gccatgcgcgagatctatgacttcatggatgacccgaagccccacaagaagctgggcccg
caggcctggctggtggcagccatcacggccacggagctgctcatcgtggtgaagtacgac
ccccacacgctcaccctgtccctgcccttctacatctcccagtgctggaccctcggctcc
gtcctggtgctcacctggaccgtctggcgcttcttcctgcgggacatcacattgaggtac
aaggagacccggtggcagaagtggcagaacaaggatgaccagggcagcaccgtcggcaac
ggggaccagcacccaccggggctggacgaagacctgctggggcctggggtggccgagggc
gagggggcaccaactccaaactga

DBGET integrated database retrieval system