KEGG   Pan paniscus (bonobo): 100994994Help
Entry
100994994         CDS       T02283                                 

Gene name
MOS
Definition
(RefSeq) MOS proto-oncogene, serine/threonine kinase
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04114  Oocyte meiosis
pps04810  Regulation of actin cytoskeleton
pps04914  Progesterone-mediated oocyte maturation
Module
pps_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100994994 (MOS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100994994 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100994994 (MOS)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100994994 (MOS)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  MOS family
   100994994 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100994994
NCBI-ProteinID: XP_003823283
Position
8
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATPPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLRCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagttttccccatcggtggac
gcgcggccctgcagcagtccctcagagctacctgcgaagctgcttctgggggccactcct
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttgctgcagaggctgggagctggagggtttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcggggtccaatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgccgcactggaggacagttaagtttgggaaagtgtctcaag
tactcactagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaggatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgcggtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcggtggtggcctacgacctgcgcccgtccctctcc
gctgccgtcttcgaggactcgctccccgggcagcgccttggggacgtcatccagcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaactcggctga

DBGET integrated database retrieval system