KEGG   Pan paniscus (bonobo): 100995445
Entry
100995445         CDS       T02283                                 

Gene name
ICOSLG
Definition
(RefSeq) inducible T-cell costimulator ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100995445 (ICOSLG)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100995445 (ICOSLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100995445 (ICOSLG)
CD molecules [BR:pps04090]
 Proteins
  100995445 (ICOSLG)
SSDB
Motif
Pfam: V-set Ig_3 I-set C2-set_2 ig DUF6338
Other DBs
NCBI-GeneID: 100995445
NCBI-ProteinID: XP_003823893
Position
21
AA seq 319 aa
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMRRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSIEVTLHVAANFSVPVVSTPHSASQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNTRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNNIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETAHWP
RLTGAHRPERGQGFRETPP
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcggctgggcagtcctggactgctcttcctgctcttcagcagccttcgagccgatact
caggagaaggaagtcagagcgatggtaggcagcgatgtggagctcagctgcgcttgccct
gaaggaagccgttttgatttaaatgatgtttacgtatattggcaaaccagtgagtcgaaa
accgtggtgacctaccacatcccacagaacagctccttggaaaacgtggacagccgctac
cggaaccgagccctgatgtcaccggccggcatgcggcggggtgacttctccctgcgcttg
ttcaacgtcaccccccaggacgagcagaagtttcactgcctggtgttgagccaatccctg
ggattccaggaggttttgagcattgaggttacactgcatgtggcagcaaacttcagcgtg
cccgtcgtcagcaccccccacagcgcctcccaggatgagctcaccttcacgtgtacatcc
ataaatggctaccccaggcccaacgtgtactggatcaataagacggacaacagcctgctg
gaccaggctctgcagaatgacaccgtcttcttgaacacgcggggcctgtatgacgtggtc
agcgtgctgaggatcgcacggacccccagcgtgaacattggctgctgcatagagaacgtg
cttctgcagcagaacctgactgtcggcagccagacaggaaataacatcggagagagagac
aagatcacagagaatccagtcagtaccggcgagaaaaacgcggccacgtggagcatcctg
gctgtcctgtgcctgcttgtggtcgtggcggtggccataggctgggtgtgcagggaccga
tgcctccaacacagctatgcaggtgcctgggctgtgagtccggagacagctcactggcca
cgtttgaccggagctcaccgcccagagcgtggacagggcttccgtgagacgccaccatga

DBGET integrated database retrieval system