KEGG   Pan paniscus (bonobo): 100995462
Entry
100995462         CDS       T02283                                 

Gene name
NKX2-3
Definition
(RefSeq) NK2 homeobox 3
  KO
K09343  homeobox protein Nkx-2.3
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100995462 (NKX2-3)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    100995462 (NKX2-3)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 100995462
NCBI-ProteinID: XP_003825733
UniProt: A0A2R9B6R3
Position
10
AA seq 303 aa
MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGE
EDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQK
SCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREH
LASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVX
XXXXXXSAAAAAHSRCTRVLQPGPRALRAPCRASGPGRDGAGHAAGTPAQPGAAGLKLEK
GLT
NT seq 912 nt   +upstreamnt  +downstreamnt
atgatgttaccaagcccggtcacctccacccctttctcagtcaaagacattttgaatctg
gagcagcagcaccagcacttccatggtgcgcacttgcaggcggacttggagcaccacttc
cactctgcgccctgcatgctggccgcagctgaggggacgcaattttctgacggaggggag
gaggacgaggaagacgagggcgagaaattgtcctatttgaactcactagccgcagcagac
ggccacggggattcagggctgtgtccccagggctatgtccacacggtcctgcgagactcg
tgcagcgagcccaaggaacatgaagaggagcccgaggtcgtgagggaccggagccaaaaa
agctgccagctgaagaagtctctagagacggccggagactgcaaggcggcggaggagagc
gagaggccgaagccacgcagccgccggaagccccgggtcctcttctcgcaagcccaggtc
ttcgagctggaacgcaggttcaagcagcagcggtacctgtcggcacccgagcgcgagcac
ctcgccagcagcctgaagctcacatccactcaggtgaaaatctggttccagaatcgcagg
tacaagtgcaagagacagcggcaggacaagtctctggagcttggcgcacacgcgcccccg
ccgccgccgcgccgcgtggcggtcccggtgctggtgcgggacggcaagccgtgcgtcann
nnnnnnnnnnnnnnnnnntcggcagcggcggcggcgcacagccgttgcaccagggtactg
cagccggggccgcgtgcgctcagggcaccttgcagggcatccgggcctggtagggacggg
gcgggtcacgcggcgggcaccccagcgcagcctggcgccgcgggactgaagctcgagaag
ggcctgacctaa

DBGET integrated database retrieval system