KEGG   Pan paniscus (bonobo): 100995511Help
Entry
100995511         CDS       T02283                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin family member 5B
  KO
K10396  kinesin family member 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100995511 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100995511 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100995511 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100995511 (KIF5B)
   04147 Exosome [BR:pps04147]
    100995511 (KIF5B)
Membrane trafficking [BR:pps04131]
 Others
  Actin-binding proteins
   Others
    100995511 (KIF5B)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100995511 (KIF5B)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100995511 (KIF5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd APG6_N DUF4226
Motif
Other DBs
NCBI-GeneID: 100995511
NCBI-ProteinID: XP_003814847
UniProt: A0A2R9A2Q6
Position
10
AA seq 963 aa AA seqDB search
MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKILRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTVDKDITLTNDKPATAIGVIGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDALSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMMLEQERLRVEHEKLKATDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGG
KQV
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggccgagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgag
tctgaagtgaaccgcggcgacaagtacatcgccaagtttcagggagaagacacggtcgtg
atcgcgtccaagccttatgcatttgatcgggtgttccagtcaagcacatctcaagagcaa
gtgtataatgactgtgcaaagaagattgttaaagatgtacttgaaggatataatggaaca
atatttgcatatggacaaacatcctctgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacctgttagatgtttcaaagaccaacctttcagttcatgaagacaaaaac
cgagttccctatgtaaaggggtgcacagagcgttttgtatgtagtccagatgaagttatg
gataccatagatgaaggaaaatccaacagacatgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaatgtcaaacaagagaacacacaaacggaa
caaaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctggatgaagctaaaaacatcaacaagtcactttctgct
cttggaaatgttatttctgctttggctgagggtagtacatatgttccatatcgagatagt
aaaatgacaagaatccttcaagattcattaggtggcaactgtagaaccactattgtaatt
tgctgctctccatcatcatacaatgagtctgaaacaaaatctacactcttatttggccaa
agggccaaaacaattaagaacacagtttgtgtcaatgtggagttaactgcagaacagtgg
aaaaagaagtatgaaaaagaaaaagaaaaaaataagatcctgcggaacactattcagtgg
cttgaaaatgaactcaacagatggcgtaatggggagacggtgcctattgatgaacagttt
gacaaagagaaagccaacttggaagctttcacagtggataaagatattactcttaccaat
gataaaccagcaaccgcaattggagttataggaaattttactgatgctgaaagaagaaag
tgtgaagaagaaattgctaaattatacaaacagcttgatgacaaggatgaagaaattaac
cagcaaagtcaactagtagagaaactgaagacgcaaatgttggatcaggaggagcttttg
gcatctaccagaagggatcaagacaatatgcaagctgagctgaatcgccttcaagcagaa
aatgatgcctctaaagaagaagtgaaagaagttttacaggccctagaagaacttgctgtc
aattatgatcagaagtctcaggaagttgaagacaaaactaaggaatatgaattgcttagt
gatgaattgaatcagaaatcggcaactttagcgagtatagatgctgagcttcagaaactt
aaggaaatgaccaaccaccagaaaaaacgagcagctgagatgatggcatctttactaaaa
gaccttgcagaaataggaattgctgtgggaaataatgatgtaaagcagcctgagggaact
ggcatgatagatgaagagttcactgttgcaagactctacattagcaaaatgaagtcagaa
gtaaaaaccatggtgaaacgttgcaagcagttagaaagcacacaaactgagagcaacaaa
aaaatggaagaaaatgaaaaggagttagcagcatgtcagcttcgtatctctcaacatgaa
gccaaaatcaagtcattgactgaataccttcaaaatgtggaacaaaagaaaagacagctg
gaggaatctgtcgatgccctcagtgaagaattagtccagcttcgagcacaagagaaagtc
catgaaatggaaaaggagcacttaaataaggttcagactgcaaatgaagttaagcaagct
gttgaacagcagatccagagccatagagaaactcatcaaaaacagatcagtagtttgaga
gatgaagtagaagcaaaagaaaaacttattactgatcttcaagaccaaaaccagaaaatg
atgttagagcaggaacgtctaagagtagaacatgagaagttgaaagccacagatcaggaa
aagagcagaaaactacatgaacttacggttatgcaagatagacgagaacaagcaagacaa
gacttgaagggtttggaagagacagtggcaaaagaacttcagactttacacaacctgcgc
aaactctttgttcaggacctggctacaagagttaaaaagagtgctgagattgattctgat
gacaccggaggcagcgctgctcagaagcaaaaaatctcctttcttgaaaataatcttgaa
cagctcactaaagtgcacaaacagttggtacgtgataatgcagatctccgctgtgaactt
cctaagttggaaaagcgacttcgagctacagctgagagagtgaaagctttggaatcagca
ctgaaagaagctaaagaaaatgcatctcgtgatcgcaaacgctatcagcaagaagtagat
cgcataaaggaagcagtcaggtcaaagaatatggccagaagagggcattctgcacagatt
gctaaacctattcgtcccgggcaacatccagcagcttctccaactcacccaagtgcaatt
cgtggaggaggtgcatttgttcagaacagccagccagtggcagtgcgaggtggaggaggc
aaacaagtgtaa

DBGET integrated database retrieval system