KEGG   Pan paniscus (bonobo): 100995559Help
Entry
100995559         CDS       T02283                                 

Gene name
GINS4
Definition
(RefSeq) GINS complex subunit 4
  KO
K10735  GINS complex subunit 4
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pps03032]
    100995559 (GINS4)
DNA replication proteins [BR:pps03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    100995559 (GINS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLD5_C Sld5
Motif
Other DBs
NCBI-GeneID: 100995559
NCBI-ProteinID: XP_003823349
UniProt: A0A2R8ZEX8
Position
8
AA seq 223 aa AA seqDB search
MTEELDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEH
MEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPS
SLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQE
NILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaactggatttcctgggacaggactctgatgggggtagtgaggaagtggtc
ctaactcctgcagagctcattgaaagattggagcaggcctggatgaatgaaaagtttgcc
cctgagctgctggagagcaagcctgagattgtagaatgtgtcatggaacagctggagcac
atggaagaaaatctcaggagagccaaaagggaggacctgaaggtcagcatccaccaaatg
gagatggagaggatccgctacgtcctcagcagctacttgcggtgtcgcctcatgaagata
gagaagtttttccctcatgtccttgagaaggaaaaaacacgtcctgagggggagccttcc
agcctctcgccggaagagttggcctttgccagagagttcatggcgaacacagagtcctat
ctgaaaaatgtcgccttgaagcacatgccccctaacttacagaaggtggacctctttcgg
gcagttcccaaaccagatctagattcttacgtgtttctgagagtgagagaacgacaagaa
aacatactggtagaaccagacacagatgagcagagggactacgtgatcgacctggagaag
ggctcacagcacttgatccgatacaaaaccattgcacctctggttgcatctggagctgtc
cagctaatttaa

DBGET integrated database retrieval system