KEGG   Pan paniscus (bonobo): 100995594
Entry
100995594         CDS       T02283                                 

Gene name
PRKCQ
Definition
(RefSeq) protein kinase C theta
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04140  Autophagy - animal
pps04270  Vascular smooth muscle contraction
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04750  Inflammatory mediator regulation of TRP channels
pps04920  Adipocytokine signaling pathway
pps04931  Insulin resistance
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100995594 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100995594 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100995594 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    100995594 (PRKCQ)
   04659 Th17 cell differentiation
    100995594 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100995594 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100995594 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100995594 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100995594 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100995594 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100995594 (PRKCQ)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100995594 (PRKCQ)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100995594 (PRKCQ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C ABC1 zf-RING_9 Kinase-like Zf_RING C1_2 zf-RING-like Pkinase_fungal APH Haspin_kinase
Other DBs
NCBI-GeneID: 100995594
NCBI-ProteinID: XP_008951372
UniProt: A0A2R9A0W2
Position
10
AA seq 706 aa
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNIERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtcgccatttcttcggattggcttgtccaactttgactgcgggtcctgccagtcttgt
cagggcgaggctgttaacccttactgtgctgtgctcgtcaaagagtatgtcgaatcagag
aacgggcagatgtatatccagaaaaagcctaccatgtacccaccctgggacagcactttt
gatgcccatatcaacaagggaagagtcatgcagatcattgtgaaaggcaaaaacgtggac
ctcatctctgaaaccaccgtggagctctactcgctggctgagaggtgcaggaagaacaac
gggaagacagaaatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tactttctggaaatgagtgacacaaaggacatgaatgaatttgagacggaaggcttcttt
gctttgcatcagcgccggggtgccatcaagcaggcaaaggtccaccacgtcaagtgccac
gagttcactgccaccttcttcccacagcccacattttgctctgtctgccacgagtttgtc
tggggcctgaacaaacagggctaccagtgccgacaatgcaatgcagcaattcacaagaag
tgtattgataaagttatagcaaagtgcacaggatcagctatcaatagccgagaaaccatg
ttccacaaggaaagattcaaaattgacatgccacacagatttaaagtctacaattacaag
agcccgaccttctgtgaacactgtggcaccctgctgtggggactggcacggcaagggctc
aagtgtgatgcatgtggcatgaatgtgcatcacagatgccagacaaaggtggccaacctt
tgtggcataaaccagaagctaatggctgaagcgctggccatgattgagagcactcaacag
gctcgctgcttaagagatactgaacagatcttcagagaaggtccggttgaaattggtctc
ccatgctccatcaaaaatgaagcaaggccgccatgtttaccgacaccgggaaaaagagag
cctcagggcatttcctgggagtctccgttggatgaggtggataaaatgtgccatcttcca
gaacctgaactgaacatagaaagaccatctctgcagattaaactaaaaattgaggatttt
atcttgcacaaaatgttggggaaaggaagttttggcaaggtcttcctggcagaattcaag
aaaaccaatcaatttttcgcaataaaggccttaaagaaagatgtggtcttgatggacgat
gatgttgagtgcacgatggtagagaagagagttctttccttggcctgggagcatccgttt
ctgacgcacatgttttgtacattccagaccaaggaaaacctcttttttgtgatggagtac
ctcaacggaggggacttaatgtaccacatccaaagctgccacaagttcgacctttccaga
gcgacgttttatgctgctgaaatcattcttggtctgcagttccttcattccaaaggaata
gtctacagggacctgaagctagataacatcctgttagacaaagatggacatatcaagatc
gcggattttggaatgtgcaaggagaacatgttaggagatgccaagacgaataccttctgt
gggacacctgactacatcgccccagagatcttgctgggtcagaaatacaaccactctgtg
gactggtggtccttcggggttctcctttatgagatgctgattggtcagtcgcctttccac
gggcaggatgaggaggagctcttccactccatccgcatggacaatcccttttacccacgg
tggctggagaaggaagcaaaggaccttctggtgaagctcttcgtgcgagaacctgagaag
aggctgggcgtgaggggagacatccgccagcaccctttgtttcgggagatcaactgggag
gaacttgaacggaaggagattgacccaccgttccggccgaaagtgaaatcaccatttgac
tgcagcaatttcgacaaagaattcttaaacgagaagccccggctgtcatttgccgacaga
gcactgatcaacagcatggaccagaatatgttcaggaacttttccttcatgaaccccggg
atggagcggctgatatcctga

DBGET integrated database retrieval system