KEGG   Pan paniscus (bonobo): 100995597Help
Entry
100995597         CDS       T02283                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin 1 (alpha)
  KO
K10373  tropomyosin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps05206  MicroRNAs in cancer
pps05410  Hypertrophic cardiomyopathy (HCM)
pps05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100995597 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100995597 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100995597 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100995597 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    100995597 (TPM1)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100995597 (TPM1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100995597 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ IncA TMF_DNA_bd Laminin_I CENP-F_leu_zip DUF1664 XhlA ERM DUF745 ADIP AAA_13 ATG16 Golgin_A5 COG2 DUF16 DUF3584 GAS SlyX Fib_alpha
Motif
Other DBs
NCBI-GeneID: 100995597
NCBI-ProteinID: XP_003827975
Position
15
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagctgagcaggcggaggccgacaagaaggcggcggaagacaggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tctgaggctctcaaagatgcccaggagaagctggagctggcagagaaaaaggccaccgac
gctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaga
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcggtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatataa

DBGET integrated database retrieval system