KEGG   Pan paniscus (bonobo): 100995657
Entry
100995657         CDS       T02283                                 

Gene name
FERMT1
Definition
(RefSeq) fermitin family member 1
  KO
K17082  kindlin 1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100995657 (FERMT1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pps04990]
    100995657 (FERMT1)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100995657 (FERMT1)
Domain-containing proteins not elsewhere classified [BR:pps04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   100995657 (FERMT1)
SSDB
Motif
Pfam: FERM_M Kindlin_2_N PH RA
Other DBs
NCBI-GeneID: 100995657
NCBI-ProteinID: XP_003821405
UniProt: A0A2R8ZHS3
Position
20
AA seq 677 aa
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTGESEADEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
VTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQD
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgctgtcatccactgactttacatttgcttcctgggagcttgtggtccgcgttgaccat
cccaatgaagagcagcagaaagacgtcacactgagagtatctggagaccttcatgttggg
ggagtgatgctcaagttagtagaacagatcaacatatcccaagactggtcagactttgct
ctttggtgggaacagaagcattgctggcttctgaaaacccactggaccctggacaaatat
ggggtccaggcagatgcaaagcttctcttcacccctcagcataaaatgctgcgccttcgc
ctgccgaatttgaagatggtgaggttgcgagtcagcttctcagctgtggtttttaaagct
gtcagtgatatctgcaaaatcctgaatattagaagatcagaagagctttccttgttaaag
ccgtctggtgactattttaagaagaagaagaaaaaagacaaaaataataaggaacccata
attgaagatattctaaacctggagagttctccaacagcttcaggttcatcagtaagtcct
ggtttatacagtaaaacgatgacccctatatatgaccccatcaatggaacaccagcatca
tccaccatgacttggttcagtgacagccctttgacagaacaaaactgcagcatcctcgca
ttcagccaacccccccagtccccagaagcacttgcggatatgtaccagcctcggtctctg
gttgataaagccaagctcaatgcaggttggctagactcctcacgctcccttatggaacaa
ggcatccaagaggatgagcagctgctcttacgatttaaatattattctttcttcgacttg
aatcctaaatatgatgctgtccgaataaaccaactctatgaacaagccaggtgggccatt
ctcttagaagaaattgattgcacagaggaagaaatgttgatctttgcagctctacagtac
cacattagcaaactgtcgttgtctgctgaaacacaggattttacaggcgagtccgaggct
gatgaaatagaagcggcgctttctaatttggaagtaaccctagaaggtggaaaagcagac
agccttttggaggacattactgatatccctaaacttgcagataatctcaaattatttagg
cccaagaagttactaccaaaagctttcaaacaatattggttcatctttaaagacacatcc
atagcatactttaaaaataaggaactcgaacaaggagaaccactagaaaaactaaatctt
agaggctgcgaagttgtgcccgatgtaaatgtagcaggaagaaaatttggaatcaagtta
ctaatccctgttgccgatggtatgaatgaaatgtatttgagatgtgaccatgagaatcaa
tacgcccaatggatggctgcctgcatgttggcatcgaagggcaaaaccatggcagacagc
tcctaccagccagaggtcctcaacatcctttcatttctgaggatgaaaaacaggaactct
gcatctcaggtggcttccagtctcgaaaacatggatatgaacccagaatgttttgtgtca
ccacggtgtgcaaaaaaacacaaatccaaacagctggccgcccggatcctggaggcgcac
cagaacgtggcccagatgcccctggtcgaagccaagctgcggttcatccaggcgtggcag
tcactgcctgagttcggcctcacctactaccttgtcagatttaaaggaagcaagaaagat
gacattctgggagtttcatataacaggttgattaaaattgatgcagccaccgggattcca
gtgacaacatggagattcacaaatatcaaacagtggaatgtaaactgggaaacccggcag
gtggtcatcgagtttgaccaaaacgtctttactgctttcacctgcctgagtgcagattgc
aagattgtgcacgagtacattggcggctacattttcttgtccacccgctccaaggaccag
aatgaaacactcgatgaggacttgttccacaaattgaccggcggtcaggattga

DBGET integrated database retrieval system