KEGG   Pan paniscus (bonobo): 100995851
Entry
100995851         CDS       T02283                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04630  JAK-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04668  TNF signaling pathway
pps05135  Yersinia infection
pps05142  Chagas disease
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100995851 (IFNB1)
   04668 TNF signaling pathway
    100995851 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100995851 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100995851 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100995851 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100995851 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100995851 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100995851 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100995851 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100995851 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100995851 (IFNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100995851 (IFNB1)
   05161 Hepatitis B
    100995851 (IFNB1)
   05160 Hepatitis C
    100995851 (IFNB1)
   05171 Coronavirus disease - COVID-19
    100995851 (IFNB1)
   05164 Influenza A
    100995851 (IFNB1)
   05162 Measles
    100995851 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100995851 (IFNB1)
   05163 Human cytomegalovirus infection
    100995851 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995851 (IFNB1)
   05169 Epstein-Barr virus infection
    100995851 (IFNB1)
   05165 Human papillomavirus infection
    100995851 (IFNB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100995851 (IFNB1)
   05152 Tuberculosis
    100995851 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100995851 (IFNB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995851 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100995851 (IFNB1)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interferons
   100995851 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead Ribosomal_S15
Other DBs
NCBI-GeneID: 100995851
NCBI-ProteinID: XP_003830711
Position
9
AA seq 187 aa
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNIQCQKLLWQLSGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKPEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LAGYLRN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcaatattcagtgtcagaag
ctcctgtggcaattgagtgggaggcttgaatattgcctcaaggacaggatgaactttgac
atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc
tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg
aatgagactattgttgagaacctcctggctaatgtctatcatcagataaaccatctgaag
acagtcctggaagaaaaaccggagaaagaagatttcaccaggggaaaattcatgagcagt
ctgcacctgaaaagatattatgggagaattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga
cttgcaggttacctccgaaactga

DBGET integrated database retrieval system